EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06261 alignment
(2 sequences with 150 aa)


O50557_ACTAC/1-149 MSGTEYAPFYLRFIQFPNNEVSLCEYWQLVQNSVKKIRRITVIFAQIIGTFSEKAIWKYQGTFNDGILEDEVAK-DVSLTLRNSALLVASAIVIHFKSNFTNLLILSQITQYHSYYPVLKKSKYSPLYFSCLLRRRLTEFKITLLPLPWG
O50555_ACTAC/1-150 MSSTEYAPFYLRFIQFPSNEVLLYEYWKLVQNFVQKVSKITVRLAQIVGILGEKTIWKYQSTFNDGMLEGEVAKQEVSLTLRNSALLVASAIVIHFKSNFTNLLILSQITQYCRHRPKSKKSKYFPLYLSCLLRRRLTEFKITLLPLPWG