EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06249 alignment
(4 sequences with 152 aa)


Q8Y7T4_LISMO/4-147 ISKELIEQLVKQVVLEKMGQSS--------KHVDPSGILSVKLPVVKVSEEDRLDTGNPSDVVYTKDLVTLEESKRLGFGLMEMKDTTFDWFLDYDEVDYVIEGRLDVVIDGRTVSAGPGEIIFIPKGSQIKFSVTGEARFIYVTYPADWQS
Q8XLY0_CLOPE/4-155 ISKELLEKLVRQIIEEKLAGAGNNDSVDFIRNKDKSGIMSIKLPTVKVDESNRLDTGNPRDVVYTKDLFTLEESPRLGAGIMEMKETTFDWTLNYDEIDYVIEGHLDIIIDGRKISADAGEIILIPKGSKIQFSVPDYARFIYVTYPADWAS
Q8RH25_FUSNN/1-148 MDKELLEELIRKVIKEELG--KAEQSESEYKQMDKSGIGVVKL--NQMKKRVKMDTGNPKDQVTTTDLFTLQESPRLGAGLMEMKETTFPWTLTYDELDYIIEGRLEILIDGRKVVGEAGDVILIPKNSKIEFSVPNYAKFLYFVYPANWSE
EUTQ_ECOLI/85-232 FTESLVAQLMEKVMKEKQSLEQGAMQPSFKSVT---GKGGIKVIDGSSVKFGRFDGAEPHCVGLT-DLVTGDDGSSMAAGFMQWENAFFPWTLNYDEIDMVLEGELHVRHEGQTMIAKAGDVMFIPKGSSIEFGTTSSVKFLYVAWPANWQS