EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06235 alignment
(6 sequences with 86 aa)


Q9MLH9_9TREM/1-85 -MCVLLVGSFVVLCGFVLSLSRFLNCLIVVENFNVLLLFSAIFQQWGESHILFIALMVIFTVEVVLGLVVLTRLWDLGSLIGRVGW
Q9GA65_FASHE/5-90 LVSFLYVGVLVIVFGFFLSLGRLLNCLIVVENLNVLLLFVCLLGQWEEFRIIFIALMVIFTIEVTLGLVVLTRLWDFSSLIGTVGV
Q9B8W8_9CEST/1-86 MVTLFLVFSSVIIISFFLSITRFLNALIILENFNVLLLLFCLIVSTNDSHIIFIVMMIISTIEVIVGLVVLTRVWECSSSLELVDL
Q953M9_ECHGR/1-86 MVTLFLLFSFVIMVSYFLAVGRFLNSLIILENFNVLILLFCLLYSSLDSHVIFIVFMVVSTVEIVISLTVLTRVWECSSCLELVDF
Q958I7_HYMDI/1-86 MVTIFLILFFTIVFSFFLSFSRFLNCLIILENFNVLLLLFCLMYSSLESHMLFIILIIISTVEVIIGLVVLTRVWECSSTIELVSF
Q9B8V0_9TREM/2-87 LIVMLLCGGGLVLISLLICGHHLFNYLIVLESYNILLLLVCLLMNINDCHIVFISMMALFVLEVSVMLIVVGTNICQGSLRISIGF