EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06234 alignment
(6 sequences with 88 aa)


Q9ZET6_XANP2/1-88 MSLFPIVGRFVGDFVPHLVAVDTSDTIDQIAEKVAVHTVGRRLPPDPTATGYEVLLDGETLDGGATLEAIMTKREMLPLQWFDVRFKK
Q9RBP1_9NOCA/1-88 MAPFPITGRFIGDFVPHLVAVDTDDTWDQIACKIAVHAVGRRIPEPEVSPGYDVLLDGTVMTPDETLGDLLGTRSIPPLQWIDVRFRE
Q51940_BURPI/1-85 MALFPVISNFQYDFVLQLVAVDTENTIDEVAAAAAHHSVGRRVAPQP---GKIVRVRRQGGEQFYPRNARLADTDIKPMEALEFIFCD
P95409_PSEAE/1-85 MALIPLISNFEGDFVLQLVPVDTENTMDEVAAAAAHHSVGRRVKPRP---GHVIRVRKQGSEELIPRTAKISEAGIKPMECLEFVWEA
TMOB_PSEME/1-83 -SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPRE----GVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFEE
O87799_PSEST/1-85 MATFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQP---EKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMD