EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06232 alignment
(5 sequences with 140 aa)


Q94E65_ORYSA/44-181 QPAGTLLQPALAADLAARTCWYTVQIKTSCASPWRTSDAVSLAFGDAYRNEVYAARLAGSSSSPQPSSSAAFERCATDTFRVGGPCGYG-VCYLYLRRSGRDGWTPQWVRVYEPTSDTPSTFYYGDPLPN-AVWYGFNRC
Q9LVB6_ARATH/31-158 HVAESFNVSLIQKLG--NTCAYTVIISTSCSSTRYTRDQISVAFGDGYGNQIYAPRLDDP-------STKTFEQCSSDTFQINGPCTYQ-ICYVYLYRSGPDGWIPNTVKIYSHGSKAV-TFPYNTYVPE-SVWYGFNYC
O80821_ARATH/31-158 LPIDSFIPKPKLENA--AACSYTVIIKTSCSSVSYTRDKISISFGDVYGNEVYVKRLDDP-------SSRTFEKCSSDTYKISGPCMRD-VCYLYLLRQGSDGWKPENVKIYGSSIRSV-TFYYNLFLPN-SVWYGFNVC
O81271_ARATH/17-148 FVTHAFDLSIIQMQQ--GTCPYTVVVMTSCLSPESTRDQISIVFGDADGNKVYAPKLGGS-----VRGPGGLGKCSTNTFQVRGQCLNDPICSLYINRNGPDGWVPESIEIYSEGSKSV-KFDFSKSVPQLNTWYGHNNC
Q9LVB5_ARATH/23-152 LTFEPLISSLDLHEE--ESCPYTVIVTTSCFSPDWSRDQVTIALGDADDNQVVAPRLDKP-----LSGGGGFEKCSSDTFQVKGKCLNT-ICSVYIYRSGTDGWIPETVEIYKEGSKSV-KFDFNKNVPE-NIWYGNNYC