EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06228 alignment
(9 sequences with 142 aa)


Q9KL40_VIBCH/49-188 MAEQLNVTEFDIVHALPEEMVAVVDGSHAQTILESLPEWGPVTTIMTIAGSIFEVKAPFPKGKVARGYYNLMGRD-.GELHGHLKLENISHVALVSKPFMGRESHYFGFFTAQGENAFKIYLGRDEKRELIPEQVARFKAMQ
Q8D3S1_VIBVU/23-162 MAERLSVTELDIVQSLPQDMAVLVKGELAQSILENLVDFGPVTTIVHAFGSIFEVKAPFPKGKEARGYYNLMGKQ-.GELHGHLKLDNVVAVALVSKPFMGKESHYFGFFSASGENIFKIYLGRDEKRELFPEQVARFKSMQ
Q93SS9_PLESH/8-148 LAARFGVSEYQLVAALPEAMAVMAHGSWAQSLLEELTDWGPLTTIVESEGSIFEFKGAFPVGKPGHGYFNLYSKEGtG-LHGHLLLSQVSHIALLAKPFMGKASYSLQFFAANGRTMFKVYLGRNKQRQLLPEQVALFEQLR
Q8EB66_SHEON/42-181 LASELGIAELEVVTALPQAQRVFLPLAHMDELLQSLPEWGSLTTIVMLSGSVFEFKGDFPQGKFAHGYYNLYSKGD.G-LHGHLKLDGMRAIALISRPFRGSESHSINFFGPQGEVVFKVYLGRDKQRVLFPDQVRRFKALA
Q9CNX4_PASMU/1-142 MASHFGKPEGEILCALPDEFVRVLPGERAEEVLAEISSWGIFTTIIEKEGSIFEIKDRFPTGMVGRGYYNLNMKDEeGTLHGHLKLDNISKIAFVSLPFRGKESYNIAFIANNGQTIFKVYLGRDAERQLFPEQVQKFKAFI
Q93SH2_BRAJA/24-162 VARGRNVTPRAVIEALPSSMVRMGGGEHFAAAMQDVAQWGEVTLIVHTDDAIFEFTGSIPAGEIGRGYFNLMQPKG.--LHGHLRHERCAGIAFVERPFMGKNSAFVAFVNADGGIMFKVFVGRDETRALRADQLARFRQLA
Q8ZJ43_YERPE/33-169 IAQDYQVSVLDVVRALPERVL--VGAEHFDRIWDSMTEWGDVTTLVHTADVILEHKGPLPSGTHRHGYFNLRSKQG.--LSGHIRAQNCQAIALLERPFMGMATASVQFFNQQGEVMFKVYVGRDEHRQLRADGLAAFHQLA
O70017_SHIDY/21-157 VAEQYNTTLLEVVINLPFSTV--VPGDKFDTVWDTVCEWGNVTTLVHTADVILEFSGELPSGFHRHDYFNLRGKHG.--MSGHIKAENCTHIALIERKFMGMDTASILFFNKEGSAMLKIFLGRDDHRQLLSEQVSAFHTLA
Q8UCM1_AGRT5/31-169 IAAKAEVAPAEILAILPQGAAVSAPADRFDAIWNEMRGWGEILMIVQTGDIVLEVPGHLPEGTESHGWFNIHGDSP.--IGGHIKKDNCAAITFVDRGFHGRRSCSVWFMNAAGGAMFKIFVRRDENKELLAGQLAKFEELR