EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06211 alignment
(2 sequences with 264 aa)


Q9DFZ0_BRARE/1-258 MDRLVSLWFQLELCAMAVLLTKGEIRCYCDAPHCVATGYMCKSELNACFTKVLDPLNTNSPLTHGCVDSLLNSADVCSSKNVDISSGSSSP-VECCHDDMCNYRGLHD-LTHPRGDSTDR----YHSSNQNLITRVQELASAKEVWFRAAVIAVPIAGGLILVLLIMLALRMLRSENKRLQAQRQQMLSRLHYSFHGHHHAKKGHVAKLDLECMVPVTGHENCCLGCDKLRQTDLCTGGGSGGERLLSLVHWGMYTGHGKLEFV
BAMBI_HUMAN/4-260 HSSYIFIWLQLELCAMAVLLTKGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQNSNSPLTHGCLDSLASTTDICQAKQARNHSGTTIPTLECCHEDMCNYRGLHDVLSPPRGEASGQGNRYQHDGSRNLITKVQELTSSKELWFRAAVIAVPIAGGLILVLLIMLALRMLRSENKRLQDQRQQMLSRLHYSFHGHH-SKKGQVAKLDLECMVPVSGHENCCLTCDKMRQADL------SNDKILSLVHWGMYSGHGKLEFV