EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06206 alignment
(9 sequences with 192 aa)


Q8YZ40_ANASP/4-194 SPQLVNLGNYLAGEFDNREQALGEPIWFVHLRLWQRPVDLFSDDSITLFAEQANIVNLDRPYRQRILRLMPAPDSETGLYVQYYMPKNPSALIGAGRHPDLLKTLTPQQLELL-PGCVLSVSQQTVAPNSYQFTASPLPNTCCTFSYLENTVQVSLGFAVTETELHTYDKGIDQETGKATWGAIVGPYRYTK
Q8YLF9_ANASP/4-186 STDIATLARWMAADFSNQAQAFENPPFYAHIRVCMRPLPWEVLSGVGFFVEQAYDYMLNDPYRLRVLKLMIVGDR---IHIENYTVKQEENFYGASRDLNRLQTLTSESLEKL-PGCNMIVEWTGN-----SFKGTVEPGKGCIVVRKGQKTYLDSEFEINEEKFISLDRGRDLETDAHIWGSVAGPFYFVR
Q8DH04_SYNEL/4-186 ATDVLTLGRWMAADFSNQAQAFENPPFYAHIRVCMRPLPRGVLEGIALYVEQAYDYLLSVPYRTRVLELMPANDH---IVIKNYVLKDEKRFFGAARDRQRLQAMTADDLELL-CGCNMLTYWTGH-----SFRGEVEPGKACKVVRKGRETYLDSTFEIDGDRFISHDRGRDPETDEHVWGSVAGPFHFVR
P74371_SYNY3/4-186 STDLSALARWMAADFSNQAQAFENPPFYAHIRVAIRPLDQAKFGDRLLFLEQAYDFMLQRPYRLRVLKLKVVEDH---IEIENFKVKDEEKFYGAARDLGKLAQLTPADLEPM-HGCDMIVEWTGT-----SFKGEVQPGRQCRVMRDGKETYLENSFEVSETGLISLDRGYDPETNERVWGSVAGAFHFVR
Q9ALZ7_FREDI/13-195 SPNLITLARWMAGDFSNYQQAFENSKDYAHIHVFFRPLPFEFFSGIGLYSEQVYDYDLWRPYRQGVHRLIDKGDE---IYIENYSLKQALYYAGAARDLNILKTITPNCIERR-YHCSMIFKREGD-----KFIGGVEPGNLCLIEKNGCQTYLDSYVEITETTWVSLDKGMDVNTHQQVWGSTFGPLRFEK
YRPA_SYNPZ/3-184 TPNVRRFLNLLCGEYSNQQQAFDNPPLYAHIFLRYRSLPQ--LKPGSILLEQTYAVDPKNPYRLRMIRAEEQPSG--AIKLWNHTFQDPARFAGATFDPALRRSIQTPDLISL-DQCHYQVVEQSD-----GYHGAMEPGCQCIVRRDGKDTVLVSSFHLQGESLQTLDRGHDPITNERCWGSVAGPFRFKR
YRPA_SYNPY/2-183 TATIGHFLQNLCGEYSNQKQAFENPPLFAHIFLRYKPIEH--LQPGSILLEQTYAVDPKHPYRLRVIRAEELTSG--IIKLWNHTFKEPDRFSSATFDQDCREKIREEDLILL-DHCHYQVRQLDD-----GFHGELEPGCRCIVRRDGKETYLVSSFHLQGDELSTLDRGHDPQTHDRCWGSIAGKFHFQR
Q98RP9_GUITH/32-217 QSLIEKFCSYIEGDWNNYDQNQKFPSLWSHIRVCFRTIPEENVGPNCFYVESAYDYMLDKPYKTVVVRIIEKDGF---IEMENFKLKSPEDFWFGSRDSSLLLNLKVDDLIKFNDDCNSIFYYKEN---EDIFYGITKPGKKCIIIRNGVKTYLDSRITLSKSKYTSWDIGRSYESELQLWGSTSGPFCFEK
Q9S330_PROMA/6-189 SQSKVLFAKILCGKYSNKDQAYHQPKLYAYMNIYFRPLPWNLFRGIGIYSEQSYDYSPWSPYRQAVHRLIVKENY---FILENYKIINAIRIAGAGFNLKLLDEIKKENLSIR-KSCEMHFQKTEE----GNYRGSLKKDEKFLIERGGIQTYLVSNVEFNKYNFNSTDQGLDIQTDSIVWGAKNGPLKFKK