EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06188 alignment
(6 sequences with 192 aa)


Q9FCZ4_ERWST/1-190 MLIRRHIDLVN-GKDDLAPVISRHQLAVQEQARTIIQEAHQRAEKIISAAEQEAEASSLLVRQRAEEAFWKRADTMFMHWQKQQQQWESDVLSVMDVVLEQALEQLLTEVPESQRLQGLLRQLLLEKTQTDKATLCCHPSQQASIATMLE-NYSHLNWQLQPEESLPPDSLKLVTPQGELYLDWQLASQQLK
Q46622_ERWAM/1-190 MLTRRRITLLN-AEADLAPVVSQAQLCIQQQGQDILEQARQQAQAMLEEAERQAEVEMLNAQQRAEQAFWQQADTLLQSWQQQYQQLEAQVLEVMDSVLTQALDQLLTDVPQTQRLAAILRQLLRAKTLTEQGSLYCHPAQHLEIADWLR-SHDHLAWQLQPDESLAQDSLKLVTANGELSLDWQQAVRQLL
Q8KUL7_ERWCH/1-191 MLTRRRLKLVAGTDVQEAELIRIEQLQQHQRGLAVIEEARQQADVLLDEARRQAHESIAVATGQAEQQFWRQADEILRGWQQEREQMESWLVSQCSQLLNDAMTQLLKTVPDAERYPALLRQLLRTQGGEGSGTLYCHPERQADVSAWLT-EHSHLGWKLSNDDALAQDTLKLITAQGVMTLSWQRAVEQLL
Q93PY3_PSEFL/1-187 MLQLHKIELHQNAASFPNPLVPREVLADVENANQLLSHAQAKADELIRRAGEKCEA----MQKQTSLEFWQRADKQLKCWEHEREGILASLEHHATLVINQAIQRILDETVEPQRLQALIQQLLASQIPQVNATLLCCPSEFEHVKKYLA-SYGATLWKLQPDATALPQTLTLRTNEGDFLINWNSMLEMLL
Q52478_PSESM/1-187 MLAKRSIALTA-ATLLREPILRREDIADSLLARDILADARQQATQILALEQEKAEH----LQQQALAQFWENANAFLGELQVQREALQEQAMTAVEELLSESLRHLLDDTTLAERARALARNLAASQLNEAVATLSVHPQIADPVAEWLADSRFSEHWQLKRDATIASDSLRLSDANGAFDIAWADLRKGLL
O87461_PSESG/1-187 MLAKRSITLTA-TALLPEPVLRREDIANSLLARDVLADAQRQAEQMLVLEQQKADL----VHQQALASFWENANAFLAELQVQREVLQQQAMAAVEELLSESLRHLLDDTTLAERAKALVKNLAGSQLNEAVANLSVHPDMAEPVAEWLADSRFAQYWQLKRDASLNTERLRLNDANGAFDIDWATLRSGLA