EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06177 alignment
(12 sequences with 173 aa)


Q9CHD7_LACLA/26-190 KTYDIVTIAIVAALYVILTMTPGLSAISYGPIQFRVSEMLNFTAFFNKKYIIAVTIGCMISNFL-S-FTWVDVIVGGLSTLVFLSLGVLLFDRFKKDYFWNGQLNKAF..FFFAIFFSISMFTIALELKFVA.GTPFLLTWGTLALGEFASLFS-GAFVMDKLGKR--VDLSR
Q8E085_STRA5/7-169 --RDYAHMAIVTAIYIVLTITPPFNAIAYGAYQFRVSEMLNFLAFYHRKYLFAVTLGCMISNLY-S-FGMIDVFVGGGSTLLFVYLGTILFKQYQKDYLFNGLINKAF..FFFSFFFAASMITVAVELKIVA.GLPLLLTWLTTAVGELASLLV-GAVLVDKLSRH--VDFTK
Q8P1L2_STRP8/5-166 TVHDYVHIGLVAALYVVLTITPPLNAISYGMYQFRISEMMNFLAFYHRKYIIAVTLGCMIANFY-S-FGLIDVFVGGGSTLIFVTLGVILFSKYQKDYLFNGIFNKAF..VYFSFFFATSMFTVAIELYFF-.GAPFLLTWFTTALGELISLLI-GSLIIDKLSQR--ISF--
Q8DT48_STRMU/5-170 TVRDLAHIAIVAALYVALTATPPLNAISYGGIQFRLSEMLNFLAFYNPKYIIAVTLGCMIANTFGT-IGLLDVFVGGGSTLVFVTLGLILFSKYKKEYIFNGLFNKAF..FYFSVFYAIFMVTIAAEISLVL.QTPFLLTWITVAVGELISSLF-GALVIDKLAQY--IDFTR
Q8DQ01_STRR6/29-193 TIRDVADIAIVAAIYVVLTVTPPLNAISYGAYQFRISEMMNFMAFYNPKYIIGVTIGCMIANFF-S-FGLLDVFVGGGSTLVFLSLGVWLFAKYSKDYLFNGLIRKDH..FFFSILFSISMFTIAAELNIVA.ELPFFLTWFTTGIGEFASLII-GAIIIGKIGRR--IDLSK
Q8Y8M9_LISMO/2-159 KMKILTVNAIIAALYVVLGMI--VAPIGFMALQFRIPEIFNHLIVFNKKYFWGIIVGVFITNLFFSGLGWIDLVFGVAQSAISLLL-MIGISKYVKGIIPRMIIN---..---TILFSVTMAIIAWELVIVF.DLPFLITWATTAASEFIVMGV-GIPLMYLLNKR--LNFRK
Q8ET24_OCEIH/2-158 NVKTLVINGVIAALYVVVSLF--IAPFGFTNIQFRISEMFNHLIVFDKRYFFGIVIGVFIVNLNSP-LGWYDLVFGVAHSAISLGI-IIFLSKFIKNKLTLLFLN---..---TIVFTFNMFIIAFALNLAL.ELPFWITWFTTAIGEFGVLLI-GIPIFYALHKR--LRFDK
O05109_LACPL/5-165 KIRPWIINALVAAMYVVLCLGPAAFSLASGAIQFRVSEGLNHLAVFNRKYIWGIVAGVILFDAFGPGASLLNVLFGGGQSLLALLVLTWLAPK-LKTVWQRMLLN---..---IALFTVSMFMIALMITMMSsGVAFWPTYLTTALSELIIMSI-TAPIMYSLDRV--LHFSD
Q8R9P2_THETN/5-160 RIKDLAEIALVAAIYFALTII--FSSISFLPVQFRIGEITKSIVVFNKKYAISMMIGNFFANLFSPFAGAMELIFMPLSNLIGCTIG----------YYIGRLTHKAIgaIFIALWIAAS---VAITLKVSA.GIPFIPTFLSVGVAETVLLVT-GYFLLFTIEKKGVVKFDR
Q97GF4_CLOAB/6-163 TLRILISNALIAAVYAVLTLT--LYFSAYGQIQVRVAEALTILPFFSGYYIVGLTLGCFVANIFS--IMKMDMLFGTLATFIAACL-TYFIGKS-KVQFKKYIA----..--PLPPVIVNAVIVGMELKIVT.HAPFLVNAICVGVGELVACYVFGLPLLAVIEKNKVLKKFM
Q8XKA2_CLOPE/5-164 NIKRIVISALIAALYATLTIA--LAPISYLGVQFRISEIMVLLAFYKKDYIVGLTLGCFIANILGP-NGTIDIVLGTFATFISVW-GIYLTGKYIKGKKAIWIAS---..---IWPTIFNGIIIGWMLNYVY.GLPLVLSMGQVALGEFVIITVIGVPVFNFINKKYFGKLNI
Q8RAG9_THETN/5-156 DVKYIAKAGVIAAIYFAVTFL--LGSVSYGPIQFRLSEALVVLPMIEPAAIWGVFIGCLLANIGSP-FGIIDILGGSFVTLIAAYL----TSKAKKFYQA--------..--ILPPIILNALFVSIWVSYFL.KMPYYIVAIDIALSEAIVTGVFGYAVLIA-YKRIKDRYSL