EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06141 alignment
(7 sequences with 133 aa)


Q8ZN03_SALTY/1-133 MSKHTLIRRAVLEKLESVTGAPVTLFDGLPAFVEQEDLPAIAVWLTDAQYTGLMTDEDDWQATLHTAVFLRAQAPDTELDIWMEEKIFPALEEVSGLERLIDTMTPLGYDYQRDSEMATWGMAEITYRITYTN
Q8ZQG6_SALTY/1-133 MNKHTQIRHAVLAKLESLSGSSAMLHDGLPVFIEPEELPALAVWLTDAQFAGQMLDERDWEAVLHVAVFLKAQAPDAELDMWMEEKIFPALEEVRGLENLINTMTPLGYDYQRDSEMATWGMAEITYRITYTN
Q8X860_ECO57/1-133 MNRHTQIRQVVLARLREQCGDSATFFDGLPAFVDAQELPAVAVWLSDAQYTGKMTDEDDWQAVLHIAVFIRAQAPDSELDMWMESTIFPALNDVSALSGLIDTLIPLGFNYQRDNEMATWAMAEITYQITYTN
Q9EYD7_ECO57/1-132 M-KHREIRAAVLSALKENISERVSWFDGRPVFIDEQELPAVAVYLTDASAADEFVDEGTWEATLHIEVFLRAKEPDSALDMWMEEKILPALEAVPGLSALLLKMNLQGYDYRRDDEFMMWGSADLLWKITYEM
Q8X3I3_ECO57/1-131 M-KHTDIRAAVLDALE-LHEHGATLFDGRPVVFDEEDFPAVAVYLTDAEYTGEELDADTWRATLHIEVFLPAQVPDSELDQWMESRIYPAVTAIPALADLITTMVTQGYEYRRDDDMALWSSADLTYSITYEM
O64326_BPN15/1-132 M-KHRDIRKVIIDALESAIGTDAIYFDGRPAVLEEGDFPAVAVYLTDAEYTGEELDADTWQAILHIEVFLEAQVPDSELDDWMETRVYPVLAEVPGLESLITTMVQQGYDYQRDDDMALWSSADLKYSITYDM
Q8ZQ90_SALTY/1-133 MTRHSAVRQAIIAALKKTDDGSTTFFDGRPVVVEEDELPAVAVYLSDAQYTGPEVDGDIWSAVLHVEVFLKATAPDSALDEQMENRVYPALGSVAGLGDIIRTMSAQGYNYQRDDEMAMWGSADLSYDITYSM