EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06100 alignment
(8 sequences with 509 aa)


Q9CGY7_LACLA/21-517 DQKSAYIIGAGLAGLATAVFLIRDGQMSGDRIHILEELPLSGGSLDGSFIPHDGFVVRGGREM-ENHFECLWDLFRTIPSLEVDDASILDEFYRIDRDDPNSSNCRIIHNRGERVDDDGKFTLSPKAQEEIIKLFMTKEELLVGKTIEDCFTDEFFKSNFWLYWCSMFAFEKWHSAIEMRRYIMRFIHHIEGLPDFSALKFTKYNQYESLVKPLISYLKDHGVDFKYGAQVENVEVDFSNGKKVAKAIVF-.--ADKEIKELTENDLVFVTNGSITESSTQGSPTQAAPKTSEL--GGSWKLWQNLAKQSEEFGHPDVFCKEIPKEAWVVSATVTWKNLKIQPYFEKLTHRQLRSGKVITGGIITVKDSNWLLSFTTHRQPHFKEQNDQETVTWVYGLLSNTPGNYIKKPIEDCTGEEITQELLYHLGMPEEEIEAFV.KENTNTIPVYMPFITSYFMLREPGDRPLVVPEQSVNLAFLGNFAET----ERDTVFTTEYSVRTAMEAVY
Q8K8E2_STRP3/21-521 DQKSAYIVGTGLAGLAAAVFLIRDGHMAGERIHLFEELPLAGGSLDGIEKPHLGFVTRGGREM-ENHFECMWDMYRSIPSLEIPGASYLDEFYWLDKDDPNSSNCRLIHKRGNRVDDDGQYTLGKQS-KELIHLIMKTEESLGDQTIEEFFSEDFFKSNFWIYWATMFAFEKWHSAVEMRRYAMRFIHHIDGLPDFTSLKFNKYNQYDSMVKPIIAYLESHDVDIQFDTKVTDIQVEQTAGKKAAKTIHMT.VSGEAKAIELTPDDLVFVTNGSITESSTYGSHHEVAKPTKAL--GGSWNLWENLAAQSDDFGHPKVFYQDLPAESWFVSATATIKHPAIEPYIERLTHRDLHDGKVNTGGIITITDSNWMMSFAIHRQPHFKEQKDNETTVWIYGLYSNSEGNYVHKKIEECTGQEITEEWLYHLGVPVDKIKDLAsQDYINTVPVYMPYITSYFMPRVKGDRPKVIPDGSVNLAFIGNFAES---PSRDTVFTTEYSIRTAMEAVY
Q8NYT3_STAAW/21-520 ENKSAYLIGSGLASLAAACFLIRDGQMEGSKIHILEELPKAGGSLDGENMPLKGYVVRGGREM-ENHFECLWDLFRSIPSLEIDNASVLDEFYWLNKEDPNYSRCRVIEKQGQRLVTDGDFTLTKKAIKEILDLCLTNEEDLDDVKITDVFSDDFFNSNFWIYWKTMFAFEPWHSAMEMRRYLMRFVHHIGGLADFSALKFTKYNQYESLVLPMVEYLKSHGVQFEYGVKVEDIKVDVTTSQKIAREILIH.RHGKAESIKLTVDDLVFVTNGSITESSTYGDNDTPAPPTDEL--GGSWTLWKNLARQSPEFGNPDKFCQNIPQKSWFVSATSTTNNKDIIDTIESICKRDPLAGKTVTGGIITINDSAWQISFTINRQQQFKDQPKNEISTWIYALYSDVNGDYIKKPITECSGNEICQEWLYHLGVPTDKIEDLA.KHASNTIPVYMPYITSYFMTRAIGDRPLVVPHQSQNLAFIGNFAET----ERDTVFTTEYSVRTAMEAVY
Q8CPN7_STAEP/21-520 DNKSAYLIGAGLASLAAACFLIRDGQMKGENIHILEELDISGGSLDGINMEHHGYVVRGGREM-ENHFECLWDLFRSIPSLEQTNASVLDEFYWLNKEDPNYSKCRAIESGGKRIDTDGDFTLTKKAIKEILNLCLMKEEDLDDVKITDVFSRDFLNSNFWLYWKTMFAFEPWHSAMEMRRYLMRFVHHIGGLADFSALKFTKYNQYESLVLPMIEYLKSHSVNFEFGVQVNNILVDATPSTKIAREIILT.RDDKEESIPLTVNDLVFVTNGSITESSTYGDNDHPAPITHSL--GGSWTLWKNLANQSPEFGRPEKFCDHIPAKSWFVSATATTDNKKIISYIEQLCKRDVLSGRTVTGGIISVANSSWQLSFTVNRQQQFKKQPKNQVSVWIYALYSDEKGDFIKKPITECTGSEICQEWLYHMGVPQEEIVELA.QSECNTIPVYMPYVTAYFMPRAYKDRPLVVPNGSKNLAFIGNFAET----ARDTVFTTEYSVRTAMEAVY
Q8DT14_STRMU/21-519 DGKSAYIVGSGLAALSTAVFLIRDGQMAGERIHILEELSLPGGSMDGIRNERLGYIIRGGREM-EPHFEVLWDLFRSIPSLENPKHSILDEFYWLNKKDPSFAKTRAIYERGKAIPDDGQLTLSQKAVKEIFDLVLTPESHLQDVQIDQVFSEDFFNSNFWLYWSTMFAFEPWASAMEMRRYLMRFIQHVGTLKNLSSLKFTQYNQYESLILPLVAFLKDHNVNFSYQTVVTNILVNRSGSDKLATKIEMT.VNGQEKSIALSRDDLVFVTNGSITESSTYGNNNHPAPLTHDL--GASWQLWKNLAAQDSDFGCPEKFCENIPDANWTMSATITFTDQRIAKYIEQINQKDPYSGSIVTSGPTSIKDSSWLLGYSISRQPHFKEQKKNELVIWLYALYTDRKGDYVAKRPDECTGIEMCEEWLYHIGVPENTIHELA.-CSASTIPCHMPYITTYFMPRTTNDRPLVVPKHSKNLAFIGNYAET----PRDTVFTTEYSVRTAMEAVY
Q8XNF5_CLOPE/30-531 ENKSAYLIGTGIGALAAGCFLIRDAHMDGSKITFFEQLDLPGGSLDGEVLQNLGYVARGGREM-GHHFEVLWGLFSSLPSTEDPNMTVLDHFFYTNYDDPNYSNCRITHKNGERYD-NAKFNLGQDLAKELAEFVLIPDEELQDKSIDEIFSEELLNTDFWTLWRTMFAFENWHSALEMKLYMNRFIHHVGGLPTLSALQFSRHDQYTSFVKPMVKFLKENGARFEYGVHVENVEFDISDDKKVAKKIVAKdKNGKDISVNLTENDLVFITNGSMTEGSGYGDDNTPAPFNKEP--QGCWELWRNIAKQSDEFGHPDKFCTDTEKSNW-ESCTVTCHDERVPKYIEKITKRSPYGGKTVTGGIVTAVDSSWLMSWTINRQEQYYGQPEKDVVVWVYGLFSDVEGDYIKKPMRDCTGKEITKEWLFHIGVPVDEIEELA.-ESCTAIPVMMPFITSQFMPREFGDRPYVVPKNAVNFAFLGQFAETLDDPGRDTVFTIEYSGRTAMEAVY
Q8DVH4_STRMU/21-521 EHKSAYIIGSGLAALSAACFLVRDGQMPGKQVHILEKDPIPGGACDGYQYSDIGYVMRGGREM-DNHFECMWDLFRSIPSIETEGVSVLDEYYWLNKADPNYSLCRATKKQGQDAHTDKKFTLSDKGAKEIMHLFFTPDEDLYNKRINEVFDGEVFDSNFWLYWRTMFAFENWHSALEMKLYLKRFIHHISGLPDFTALRFTKYNQYESMILPMIKYLESFGVVFHYNTKVVNITFDIQKDKKAAKSIAVI.RDGQGEKIDLTENDLVFITNGGCVENSSYGSQDKAAVFNCEIREGGGWDMWRQIAKQDPSFGHPDKFCYDPEQTNW-MSATVTTLDDKIPPYIQKICKRDPFSGKIVTGGIVTVRDSNWLMSWTINRQPQFHNQPKDQLVVWVYALFSDKEGDYIKKPMRDCTGKEICAEWLYHLGVPLSEIDEMA.KKSAKTVPCMMPYITAFFMPREEGDRPDVVPQGAVNFAFLGQFAQT----KRDTIFTTEYSIRTGMEAVY
Q8Y9P3_LISMO/47-535 GDKQVYFVGGGIASLAGAVYLIRDANFDGKNIHIIEGMHILGGSNDGAGSVEHGFVCRGGRMLNEETYENFWDLFSSIPSLDMPNFSVTEEILNFDHLHPTHAQARLVDKDRNILDAHS-MGFNNNDRMLMTKLLATPEEKLDNLTIRDWFDEHFFETNFWYMWQTTFAFQKWSSLFEFRRYMNRMMLEFSRIDTLEGVTRTPLNQYESLILPLKTFLDKHHVDFTINQTVEDIDF-----KDAPGITATAlHLSDESTIELGPDDDVIMTNACMTDSATLGDMNTPAPKPEEK--PISGELWYKVAQKKPNLGNPEPFFAHEEETNW-QSFTVTCHGDKLLKRIERFTGNIP-----GSGALMTFKDSNWLMSTVVAAQPHFKAQDANTTIFWGYGLYPDRVGDFVKKPMKECTGEEILYELMCHLNWQDDFEEIKA.-DIINVIPCYMPYIDAQFEPRAMSDRPAVVPEGSTNFAMISQFVEI----PKDMVFTEEYSVRAARIAVY