EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06068 alignment
(17 sequences with 328 aa)


Q8ID85_PLAF7/117-433 RRSIGVRVKEESEVIEGEVVEIEIEKFNERD-.INNKNKKLGKMILKTTEMETLYDLGSKMIEALQKENITAGDVICIDKGTGKITKIGKSFARSKDYDAMDPNTLFVQCPEGELQKRKEVVHTVTLHDIDAINSRTQGFL.-------ALFSGDTGEIKNEIREHIDMKINEWQEDEKAEIVPGVLFIDEVHMLDIECFSYLNRALESEQSPIVIMATNRGITHIRGT-DYKAPHGIPLDLLDRTLIIPTYPYKHQDILKILEQRAEEEDVDIDEYAKELLCKIASESSLRYALHLITLANLVSKKRKATEVTVQDVRRVYNLFIDV
RUVB2_XENLA/123-435 RRSIGVRIKEETEIIEGEVVEVQIDRPAT---.--GTGAKVGKLTLKTTEMETIYDLGTKMIESLTKEKVQAGDVITIDKATGKITKLGRAFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFL.-------ALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIECFSFLNRALESDMAPVLIMATNRGITRIRGT-NYQSPHGIPIDLLDRLLIISTSPYNEKETKQILKIRCEEEDVDMSEDAYTVLTRIGLETSLRYSMQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDE
Q9FJW0_ARATH/120-433 RKAIGVRIKEETEVIEGEVVEVQIDRPAS---.S-GVASKSGKMTMKTTDMETVYDMGAKMIEALNKEKVQSGDVIAIDKATGKITKLGRSFSRSRDYDAMGAQTKFVQCPEGELQKRKEVVHCVTLHEIDVINSRTQGFL.-------ALFTGDTGEIRSEVREQIDTKVAEWREEGKAEIVPGVLFIDEVHMLDIECFSFLNRALENEMSPILVVATNRGVTTIRGT-NQKSPHGIPIDLLDRLLIITTQPYTDDDIRKILEIRCQEEDVEMNEEAKQLLTLIGRDTSLRYAIHLITAAALSCQKRKGKVVEVEDIQRVYRLFLDV
Q9M2X5_ARATH/120-434 RKAIGVRIKEETDVIEGEVVTISIDRPAS---.SGGSVKKTGKITMKTTDMESNFDLGWKLIEPLDKEKVQSGDVIVLDRFCGKITKLGRSFTRSRDFDVMGSKTKFVQCPEGELEKRKEVLHSVTLHEIDVINSRTQGYL.-------ALFTGDTGEIRSETREQSDTKVAEWREEGKAEIVPGVLFIDEVHMLDIECFSFLNRALENDMSPILVVATNRGMTTIRGT-NQISAHGIPIDFLDRLLIITTQPYTQDEIRNILEIRCQEEDVEMNEEAKQLLTLIGCNTSLRYAIHLINAAALACLKRKGKVVEIQDIERVYRLFLDT
Q12464_YEAST/122-433 RKSIGIKIKEETELIEGEVVEIQIDRSIT---.---GGHKQGKLTIKTTDMETIYELGNKMIDGLTKEKVLAGDVISIDKASGKITKLGRSFARSRDYDAMGADTRFVQCPEGELQKRKTVVHTVSLHEIDVINSRTQGFL.-------ALFTGDTGEIRSEVRDQINTKVAEWKEEGKAEIVPGVLFIDEVHMLDIECFSFINRALEDEFAPIVMMATNRGVSKTRGT-NYKSPHGLPLDLLDRSIIITTKSYNEQEIKTILSIRAQEEEVELSSDALDLLTKTGVETSLRYSSNLISVAQQIAMKRKNNTVEVEDVKRAYLLFLDS
Q9GZH2_CAEEL/120-432 RRALGIQIKEETEVLEGEVISLEVDRSAN---.--GMGPKVGKLTMRTTDMETIYDLGSKMVDACLKEKVMPGDVIQVDKASGRVTRLGRSFNRSHDYDAMGPKVKLVQCPDGEIQKRRETVHTVCLHDIDVINSRTQGYV.-------ALFSGDTGEIKAEVRDQINKKVLEWREEGKAKFVPGVLFIDEAHMLDIECFSFLNRAIEGELSPLIIMATNRLIEKVRGT-DVESAHGIPSDFLDRMLIINAIPYTKEDTAKILSIRCDEEGVKLQPTALDLLVKLQEATSLRYCIHLIAASEVIRIRSKAEIVTTDHIGSAYRLFFDT
Q8SU27_ENCCU/111-409 RKSVGLRIKESVKVIEGEVVSL----------.------SGRRIVLKTVDMESSFEIGEKMRGELDKEKVSAGDVIRIVRERGRVYKIGTSMVKRS--DVVGTDTRFVPCPEGELIRITEETQEISLHDIDVVNSKAEGYL.-------ALFSGETGEIRAETRDEVNKKVWGWINEGKAEIVRGVLFIDEVHMLDIESFAFLNKAVEEDFCPVILVSTNKGECIVRGT-DEPSPYGIPRDFIDRALIISMEKHCRRDLEAILRHRILEEDILIDDDAVDRLVSISEASGLRYSMNLLTISSMRASRRNGR-VALGDVERAFELFLDE
Q9YFB5_AERPE/141-458 RKAIGVRVRERREVVEGVVTSISVSKRRTPF-.SPYPVIAGARITLETKDESRTFTVGPEVAEQLVALGVRRGDVIVIDLETGVVRVVGRGKGRGQSFDI--DVVREVELPEGPVRKVKEFVRTLTLHDIDASIAAQRVAFtGLL----SMFEAERG-VTSEDRKKTDELVKKWVGEGKAEIVAGVIFIDDAHLLDMESFSFLSKAMESDLAPIIVLATNRGVAKIRGT-DIESPHGIPRDLLDRLLIITTRPYTRDEIKEIIRIRADEEEVLLSENALERLADIGSEKSLRYAIQLLEPAMIVAKRRGSRRVEAEHVEEAERLFADI
O28462_ARCFU/117-432 RKAIGVRIRETRTVLEGEVVGLDYNMVPNPYN.PTQKIPESATLTLATKDEKRTFSVGGRLAMQFFTQGIEVGDVIVIDKETGRIGKLGRSEKAKKKYDL--GDDEVVPVPSGKVEKEKEFTYVVTLHDLDEANARRTSIF.-------SLFSPPSREIDNEVREAVDEQVKRLVEEGRAELVPGVLFIDETHLMDIELFAFMNRAMESEMAPIIILASNRGFSRIRGT-DIVAPHGIPLDLLDRLLIITTEPYSREEIKTIIEIRAAESGIMLSNEAMEKLTDIGEKTSLRYAVQLLAPAYEFAKMRNSGKVELEDVERAASIFADV
Q8IAT2_PLAF7/188-504 RKSIGVKIKEIKEVFEGEVVQIEPFFDNT---.YDEQKISYVHITLKTLKEQKKIKIHSSIYDNLLKEKIQEKDIIYIESHSGNVKRVGKCSLYQDMFDI--ETDTFVDLPKGNVHKKKNIIQNITLYDLDVSNVQPKDNIlDFL----QNNKSKKTEITDKLRNEINKIVYKYVDQGIAQIIPGVLFIDEVHMLDIECFTYLNRTLESNLAPVVILATNRGICNIKGT-NIISAHGIPVDLLDRIIIVKTMLYNKEEILQVLKLRCKFERIKIDSEALDYLSDIGIKCSLRYAIQLLTPAKILSKKKGKKKIDKNIIEIVSSIFFDT
O17607_CAEEL/136-440 RRAIGLRVKETKDVYEGEVTELSPVEASDNS-.GMGKTISHLVLSLKTAKGSKQLKLDPSIYDSILKQRVEVGDVIYIEANSGIVKRVGRCDVYASEFDL--EADEFVPMPKGDVRKSKDIVQNVSLHDLDIANARPQGRQgDVSNIVSQLMTPKKTEVTDRLRSEINKVVNEYIESGVAELMPGVLFIDEVHMLDVECFTYLYRALESPMAPVVVFATNRGTTTVRGL-GDKAPHGIPPEMLDRLMIIPTMKYNEEDIRKILVHRTEAENVQFEEKAFDLLTRLCAQTC------------------GREVIEVEDVDRCTKLFMDR
Q03940_YEAST/126-449 RRAIGLRIKETKEVYEGEVTELTPEDAENPLG.GYGKTISHVIVGLKSAKGTKTLRLDPTIYESIQREKVSIGDVIYIEANTGAVKRVGRSDAYATEFDL--ETEEYVPLPKGEVHKKKEIVQDVTLHDLDVANARPQGGQ.DVISMMGQLLKPKKTEITEKLRQEVNKVVAKYIDQGVAELIPGVLFIDEVNMLDIEIFTYLNKALESNIAPVVVLASNRGMTTVRGTEDVISPHGVPPDLIDRLLIVRTLPYDKDEIRTIIERRATVERLQVESSALDLLATMGTETSLRYALQLLAPCGILAQTSNRKEIVVNDVNEAKLLFLDA
Q9C0X6_SCHPO/118-441 RRAIGLRVKETKEVYEGEVTEMVPEEAENPLG.GYGKTISHVLLGLKTHKGTKQLKLDPSIYESLQREQVSTGDVIYIEANTGAVKRVGRSDAYATEFDL--EAEEYVPMPKGEVHKRKEIVQDVTLHDLDIANARPQGGQ.DIMSMMGQLMKPKKTEITDKLRGEINKVVNKYIEQGIAELIPGVLFIDEVHMLDIECFTYLNQALESTISPIVIFASNRGICTIRGTEDIQAPHGIPTDLLDRLLIVRTLPYSESEIRSILQIRAKVENIILTDECLDKLAQEGSRTSLRYVIQLLTPVSIIASLHGNKEIGVQDIEECNDLFLDA
Q8WZS3_NEUCR/118-441 RRAIGLKVRETKEVYEGEVTELTPEEAENPLG.GYGKTITTLLIGLKSAKGQKKLRLDPSIYEAIQKERVTVGDVIYIEANTGACKRVGRSDAYATEFDL--EAEEYVPIPKGEVHKKKEIVQDVSLHDLDVANARPQGGQ.DIMSMMGQLMKPKMTEITDKLRSEINKVVSKYIDQGVAELVPGVLFIDEAHMLDVECFTYLNKALESPISPIVVLASNRGMTGIRGAEDLVAAHGIPPDFLSRLLIIPTTAYDPEEIKRIVKIRSTTEGVKITEAAIDKIAEHGVRISLRYCLQLLTPASILAKVNGRNEIDVQDVAECEDLFLDA
RUVB1_XENLA/117-440 RRAIGLRIRETKEVYEGEVTELTPCETENPMG.GYGKTISHVIIGLKTAKGTKQLKLDPSIYESLQKERVEVGDVIYIEANSGAVKRQGRSDTYATEFDL--EAEEYVPLPKGDVHQKKEVIQDVTLHDLDVANARPQGGQ.DILSMMGQLMKPKKTEITDKLRGQINKVVNKYIDQGIAELVPGVLFIDEVHMLDIECFTYLHRALESSLAPIVIFATNRGNCIIRGTEDVASPHGIPLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKINGKDSIEKEHVEEINELFYDA
Q8IIU3_PLAF7/136-459 RKSIHIKIKEEKLVYEGEVVDMVVEENECLYSlNKAKQINAIIITLKSVKGSKTLRLAPKIHEQIAREKIKIGDVIYIETNTGHVKRLGRCNDYAKEYDI--EFDEYVSLPKGEVHKKKEVVQQISLHDIDLANANPTVGE.DLASVLNSYLRPKKTEITEKLRVEINKTVNKFLESGLAEIIPGVLYIDEAHMLDIECFSYLNRAIESPLAPILIMATNRGICTVKGT-DNIEPHGIPVDLLDRLIIIKTFPYTLKEIVQILALRAQTEKINITEEGMNYLAKIGIQSSLRFAMLLLEPSRILATLEGNTIIDIKHIEQADELFMDA
Q8STP2_ENCCU/109-426 RRSILVRMRELKDVYEGEVVELRIVDEENPLS.SYPKRIKEMFVILKTSKESKKLKLAPSLYEQIDKQRIVNGDVVYIEVNSGVIKKLGRSEAHMNDFDL--EADTYVPIPKGEVLKRKEVMQSVTLHDLDMANARPSGQ-.DMLSLVFRILSPRKTEITERLRGDVNRMVNGYLENGNAEIVPGVLFIDEVHMLDVECFTFLHKVIESPLSPTIIFASNKGMAPIKGSDGLLGPFGITKDLLDRIVIISVKRNPDEANREIIRRRMKEEGLEMDDDAFGFFVGLSTSRSLRYCISLIPLLKTY-----GGCVSVRNVEEVAELFHDS