EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06066 alignment
(4 sequences with 100 aa)


O54598_ECOLI/1-99 MEAANLSPSGAVMPLATSLSGNNSVDEKTGVIKPENGTNRTVRVIAGLALTTTALAALGTGIAAACSETSSTE-YLALGITSGVLGTLTAVGGALAMKYA
Q93FL0_9ENTR/1-100 MEPTNLSPSGVVLPLATAINGNGPVDENTGVMQAEGGASRNVRVFAGVALAVSALAATGAGIAAMCIDNSSQTEKLGLGIAAGVLGGLTSVGGALAMKYA
O52300_ECOLI/1-98 MDAANLSPSGRVLPLAATINGNNPVDETTGVMQPENGTNRTIRILGGVLISAGALAAIGAGIASLCVEDPSQK--LGLGIAAGVLGGVTTLGSGLAMKYA
O52301_ECOLI/1-100 MDAANLSPSGGVLPLAATINGNVSVDENTGVMTPENGVSRNIRIAAGIALATTALAALGTGIAMACTTNASSQEFLGLGIATGVLGGVTALGGGLAMKYA