EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06057 alignment
(12 sequences with 194 aa)


Q9PFC4_XYLFA/34-225 SDRLAIMISGDGGWRTLDRNLSKELQRRGISVVGWNSLRYFWKLRTPEQLGDDLSRVIADYQRRWGAHQVILIGYSFGADVMPFAYAHLMPTQRNGVDFISLLALGRKADFKARIFGWLGWGEHGTR-DVLTALGALDLHRVQCIYGQNDKD-AVCPELRERIFDVVMRPGGHHFDGDTVKLADAILQGWQRRI
Q8P8D8_XANCP/218-409 SDRLVVLLSGDGGWREMDKGIAARLQQQGVSVVGFNSLRYFWGSRTPQQVGVDLDRIIATYQQRWHAHHVALVGYSFGADVLPFAFPELPAARRDAVQFVGLLGLAHQADFKVRVGGWLGWHNEAER-PIAPALQALDAHRLQCIYGEQEKD-TLCPELRARGVEVIARPGGHHFDRDPGALADILLQGWQRAA
Q9PA41_XYLFA/263-452 SDTFAIFVSGDGGWAEIDKKVAGHLADADIPVVGLDSLRYFWSERTPEGFAKDLDRIARFYAHHWKRNRLLLVGFSQGADVLPAAINKLSPNTRQIIRMTALLSLGKYAHYEFHVSNWISTDDEGI--PIAPDMVKLRSTRTVCIYGVDDQE-TLCPSLPQQNR-RVALPGTHHFNGDYETVAKTILAQMEAAP
Q8PMQ8_XANAC/265-455 DDTFVIFVSGDGGWAGLDEEVADALAAQGIPVVGLDSLRYFWTERTPQGFADDLDRIARIYAQRWDRQRVVLIGFSQGADVLPAAINKLPAATKQNLRMTALLSVGKLADYEFHVSNWLGSDDEGL--PIAPEVQRLPAGTTVCIYGQDDDD-ALCPSLPANVARRVALPGDHHFKGDYATLAKTIMDQLHALS
Q8XPW5_RALSO/410-600 SELFAVLLSGDGGWAGLDKEVAAALSKSGVPVVGVDSLRYFWTPRTPASAAADMDRLVRFYAARWKKTKALLIGYSQGADVLPFIVNRLPAASREHVALAVMMGLGKRADFEFHMTNWVSSSASGL--LILPEVQKLPTGLGMCIYGRDEKD-SNCPSLDPKQVQLVKLPGGHHFDGDYAKLARIILEGARGPG
Q92QW4_RHIME/1-190 ---MAVIYSGDGGWRDIDKEVGNALQQQGVPVVGVDSLRYFWSERQPQATADDLARVITYYGRRWNVRNVLLIGYSFGADILPRTYNLLPSATRARVRQVTLMALSHRADYKISVLGWLGADGEGNAGDPVDDIKAIEPALVQCIYGTDEED-DACPDLKSSGIDVVSIEGGHHFDGDYAALTRRVLDALDRRL
Q8UCG5_AGRT5/261-454 MDTMAVIYSGDGGWRDLDEEVGSALQKQGVPVIGVDALRYFWKEKDPKEVAGDLARIIDTYRKEWKVKNVVLIGYSFGADIIPATYNLLPDRVKSSVAQLSLLGLSNEVDFEISVQGWLGVAGEGKGGKTVDDIAKIDPKLVQCVYGTEEEDEDPCPGLKAKGVETIGIEGGHHFDEDYEALAKRIVTSLKTRL
Q8GQE4_RHITR/265-458 EDTLAIVYSGDGGWRDIDKEVGSYLQDQGIPVVGVDTLHYFWTEKDPQQTANDLGRIIDFYTKRFKVKHVVLVGYSFGADVLPASYNRLPQAEKDKIVQMSLLSLSQKVDYVISVMGWLGASSQGKGGDPVNDLKSINPKMVQCVYGKDDDEDVACPLLKGTGAEVIAMDGGHHFDDDYEALANHIINGLKSRL
Q53472_9ZZZZ/52-244 KNTVAIIYSGDAGWQNIDEVIGTYLQTEGIPVIGVSSLRYFWSERSPSETAKDLGHIIDVYTKHFGVQNVLLIGYSFGADVMPASFNRLTLEQKNRVKQISLLALSHQVDYVVSFRGWLQLETEGKGGNPLDDLRFIDPAIVQCMYGREDRN-NACPSLRQTGAEVIGFSGGHHFGNDFKKLSTRVVSGLVARL
Q44405_9RHIZ/261-454 MDTMAVIYSGDGGWRDLDEEVGSALQKQGVPVIGVDALRYFWKEKDPKEVAGDLARIIDTYRKEWKVKNVVLIGYSFGADIIPATYNLLPDRVKSSVAQFRCSAFPMKWILKSQFRDGLAWLVKARAARPSMTSPRSTPSWCNAFMAPRRKMKIPAPASRQRVSKPSASKAGTISTRITKALAKRIVTSLKTRL
Q9I538_PSEAE/232-422 SDIVTLFYSGDGGWRDLDKDSAEHMASMGYPVVGIDTLRYYWQHKSPEQSAADLSKLMQHYREKWGAKRFVLAGYSFGADILPAIYNRLPGKDQQQVKAMLLLALARTGSFEIEVEGWLGKAGEEAATG--PEMARLPAAKVFCIYGAEEKD-ESGCTQSQAVGEKLELPGGHHFDEDYLSLAKKMLQAIRDRE
Q8FW75_BRUSU/190-378 ADMVAVFYSGDGGWRDIDKSIGEWLQAHGVHVIGVDSLRYFWSERTPEEIANDTTAMIKKADPT-GKLPVAVLGYSFGADTFPFAWKYLDPSIQDRTRMVGLLGVETTTTFQVSIEGWLGMNGDK---DVVPAIASIPLDRVVCVYGQEEDD-TACTADELKGMDTIKLPGGHHFDENYEPIAAALLDKMRSRA