EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06035 alignment
(11 sequences with 190 aa)


Q98NJ0_RHILO/19-202 AVAGSA-----HAAPASMVVGGSTSQPIGHYDFCKIHVAECSIRSPDSVPEHLTSKLLHDISAVNLSVNTRVKPMSDMDNYGKDEWWAYPDNGFGDCEDYALEKRRELNSLGIAIANLLMTVVRKPDGEGHAVLTVRTDKGDFILDNLTDKVRLWNQTSYRYLKRQASDNTGHWVSILGGD-EQLVSAVK
Q98DU1_RHILO/16-204 AAGLAATGSWPAMAAGAMATGGITSQPIGHYDFCKLHPGECSIRPSNLAPAKMTNGLMRKLAGVSARVNAAVKPMSDMDIYGKDEVWAYPDKGVGDCEDYVLEKRRRLSHMGISLADLLITVVRKTDGEGHSVLTVRTDKGDYVLDNLTDKVKAWDQTGYRFLKRQAIDNTGRWVSIRGGQ-QVLVGSVE
Q92ST4_RHIME/41-224 NTAIPAQ----AGATPWMQTGAVTSQPIGHYEFCQKYRGECNVRSKAKVPPRVTAGGWAAIRQVNASVNRQIAPVTDIELTGRDEVWSYPGR-QGDCEDFALEKRRRLMQKGFSAGNLLMTVVRKPDGEGHAVLTVRTAQGDFILDNLDDGVRLWTHTPYRFLKRQATNHSGRWVTIDNSG-EVLVGSVG
Q8UIP1_AGRT5/21-204 AASAMAE----IKGSPSMVTGGITSQPIGHYEFCQKYADECNIRSKVTPPPRVTDYGWGVIREINTSVNTTIVAMTDQEIYGKDEVWEYPTTA-GDCEDFVLLKRKKLIERGFSVADLLITVVRKPDGEGHAVLTLRTTDGDYILDNLTDDVKLWTDTNYTYLKRQASFNTGRWISIEDGR-DVLVGALR
Q98ND9_RHILO/18-202 SAWGSAYAA----GPAYMHTGGRTTQPVGHYEFCQRIPGECNEKTPKGAPVDLSRKLWATIVNINNSVNTRVKPRTDMENYGVEEYWAYPDNGYGDCEDYALEKRRELMDAGVPAGDLLMTVARQPNGDGHAVLTVRTSLGEFILDNLETKVLSWTDTDYTYLKRQSTENSGVWVTINDGR-SDAVASVR
Q8G056_BRUSU/14-201 LGAGLAQAANPASTSPWMTTGERTSQPIGHYELCQRHPAECSSTSRSSASLKLTQRLWQQIIDVNERVNTTIAPMTDMEVWGQEEYWEYPTTA-GDCDDYMLLKRRELMALGVPANTLLFTVVRQPNGEGHAVLTVRTDRGDFILDNLDPRVLAWNKTDYTYLKRQSTYSTGSWVSIRDDR-DILVGSIH
Q8FXW4_BRUSU/23-206 LAGFAAQAA----SGDFMQTGKITSQPIGHYEFCKREARECAITSRDTRALKLTPANWQHIIEVNFSVNERIKPMTDMEIYGIEEYWAYPTT-VGDCEDYVLLKQRELHQAGIPLTDLLITVVRKPNGEGHAVLTVRADRGDFVLDNLTDEVMRWDETDYTYLKRQAANHTGRWVTIEAPD-NLLVGSVR
Q92QC1_RHIME/18-200 LIAGPAYAV-----PANMTVGGATNPPIGHYEFCKANPSECAAIGADHGPSVLTRDSWKKILEVNYEVNQAIAPMTDMEIHGVEENWSYPDA-VGDCEDYVLLKRRRLIESGFSPADLLITVVLQPNGDGHAVLTVRTDRGDFILDNMRSKVLLWSDTEYTYLKRQSSEHAGRWVKLQDGR-ALAVGSVS
Q8UEK0_AGRT5/18-202 AFAHQASAS----PAAVMRVIGKANPPIGHYEFCQTYQSECQPTSLDNGPLQLTEERWKTMLDVNYTVNTTITPMTDMEIYGVEERWAYPTT-VGDCEDFVLLKRKMLMNKGFSPSNLLITVVLQPNGEGHAVLTVRTDRGDFVLDNMRNKVMNWSETEYTYLKRQDTANPGRWVKIQDGRATAAVGGIR
Q8U7U2_AGRT5/16-199 VVGLAAP----AQASPSMQTGRITSQPVGHYDFCQRHSAECQP-VKSMPPVSLTPDVWATLVSVNNAVNTEIDQRTDMEVWGYEDYWEYPYNGAGDCEDLALEKRKRLMDAGLPVSDLLITVVRDEKGDGHAILTVRTDRGDFILDNMKPKIFRWDETPYTYLKRQSTEHAGRWVDIEGTG-SPAIAARE
Q8FV24_BRUSU/2-184 TLFGAAGIP-SAKAAQWSEAGGLTSIPYGHKEYCNRNPRNCGAH-RVLPPMKLTPQRMKLLQSVSSSVNHRIKPVSDQENYGKRDYWTMPVNGKGDCEDYVLMKRAQLMARGISPSQLLITMVQ--GSEAHVVLAVRTDRGDYILDNLRDEVLPVEKTSYRYIKMQSPANAGQWVSIAGR-SVAVANN--