EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05991 alignment
(13 sequences with 181 aa)


Q9KGF1_BACHD/2-169 REILIVDGYNMIGAWPELKEL-KDR-DLALARDKLIDRLAEYQAYTGCKVI-LVFDAHMVPG-VGRT-YNNHRIEVIYTRKNETADERIERLVRELKRID....-TQIYVATSDLAEQSHIFGSGALRKSARELYNEMEVTGKGIEKTVEKSNKEHNSTK---IALTEELAEIFEKWRRGD
YACP_BACSU/1-168 MDILLVDGYNMIGAWPQLKDL-KAN-SFEEARDVLIQKMAEYQSYTGNRVI-VVFDAHLVKG-LEKK-QTNHRVEVIFTKENETADERIEKLAQALNNIA....-TQIHVATSDYTEQWAIFGQGALRKSARELLREVETIERRIERRVRKITSEKPAGK---IALSEEVLKTFEKWRRGD
Q8YAA9_LISMO/2-169 EQILLVDGYNVIGAWPELSYL-KDR-DLEAARDKLVEWMAEYQSYTGYRVV-VVFDAQFVRG-VKRK-SKKYQVEVVFTHEDETADEYIEQKAIEWKNVR....-TQIMVATSDYTEQWAIFGQGALRISSRELLFEIQEMSKQIGKKIKRIQEEMPKSN-L--NLDSDVISQLEKWRRGE
Q8ETZ7_OCEIH/2-169 KEVLIVDGYNVIGAWGELQRL-KEK-EIGQARDRLIEVLAEYQAFTGKHVI-LVFDAYYVRG-VENK-QQKFNIEIIYTKEKETADECIEKLVKEVKNIQ....-TQVYVATSDYAEQRTIFGQGALRKSARELLIEVQDMDREIHVSLEVHRKTKPQAK-I--KIDKEIMEKFEQMRRGE
Q8CTT8_STAEP/3-171 KRYLIIDGYNMIGQSSTLSTV-AKE-NLEEAREQLLDTIANYNALIADEIV-CVFDAYEQSG-IERE-YFYHGVKTIFTKEKETADSFIERYVYELYNKH....TTHITVVTSDMSEQHAIFGSGAYRISSREMWRELKENEVVVNKSLDDFSEKKPRIR---IPLSNEILEEFEKIRRGN
Q8K5U0_STRP3/3-170 KRILLVDGYNMIAFWQSTRQLFKTN-QLDQARNTLLTKLNHYAHFENINII-CVFDAQYVPG-LRQR-YDQYYISVVFTEEDETADSYIERMAAELN-TA....IHMVEVATSDLNEQWTIFSQGALRVTARELEQRVHTVKADLDKMSRDIDLKTPKLR----PFDQGQLSQLKDFMSQL
Q8E1Z1_STRA5/4-172 HSILLVDGYNMIAFWKDTRQLFKSN-RLEEAREVLLRKLNHYAHFEHIDII-CVFDAQYVPG-VRQR-YDQYKISVIFTEEDETADSYIERAAAELNQSV....LNLVSVATSDLNEQWTIFSQGALRVSARELEQRVATVKSDLDKMSSQIDLSTPKLR----PWNDEQLGKLKDFLDGM
Q97EG0_CLOAB/1-172 MKTILVDGYNVINSWGKLNSI-KDDVSLESARDKLIEVLVEYGEFTNCKII-VVFDAHHIPGNTGEKIKMYDKFTIVYTKAGETADSFIERYVNKVGRK-....-SEVCVVTSDNLEQQVVFQRGSTRMSSIEFYNDVQKIHGRISKKAEKIRNEKKYNR-LEDRIDKNIMEKLDKIRKNL
Q8XHQ9_CLOPE/1-169 MRVIFIDGYNVINSWPNLKKS-KNY-SYDIARTELTEMLENYAAFNSCKIY-LVFDAHKVAGNIESK-ELSGNIITVFTKEGEIADAYIERMVDELGRK-....-VEIVVVTSDRLEQQTIFQRGAVRMSSIEFYNEVLKVQDNIRKKAEKNKLELGKN-FLGDTLEESVLEKLEKMRRG-
Q8R7T6_THETN/2-167 PLYMLVDGYNVINNWQMLKEI-AKR-SLEDARDKLIDLLADFKGYTGINII-LVFDAMYVKGSLEKH-EEINGIEVVYTKEGESADHFIESKVVELVKK-....-EDVVVVSSDWIVQQVVMAHGAIRMSARELYEEMNRYIEKHKKEYMNTFYKDN----LENRLDEETVKKLRQMREN-
Q8YNL9_ANASP/7-182 PAVLLVDGYNIIGAWPCLKKT-RDKNGLEAARGQLVEAMTSYSSFQGYDTQ-IVFDAHYQNT-CSNKEIITELVSVYYTDFGQTADTYIEKICASLRPEVsqarISRVIVATSDRAQQLTVQGYGAEWLSAYQLCGEVETTVCRMRQKYQSRKQS--KSRFLASAIDPKARQKLAELRMGI
Q8GZ36_ARATH/130-301 VPVLLVDGYNVCGYWMKLKKHFMK-GRLDVARQKLVDELVSFSMVKEVKVV-VVFDALMSGL-PTHK-EDFAGVDVIFSGET-CADAWIEKEVVALREDG....CPKVWVVTSDVCQQQAAHGAGAYIWSSKALVSEIKSMHKEVEKMMQETRSTSFQGRLLKHNLDSEVVDALKDLRDKL
Q8F3Z2_LEPIN/44-209 LFQVAIDGFNLIYKFPDLEESMYQN-RLSDARRTLLEWIELYSKKKKKQNFHIFFDGKKEIG-NEVL-QETFGKLNVYYSRDRKADDLIKEFVRTQIRP-....-ADVQVVSSDKEIFYHAKKWGAHPITSEEF-ASIVTAEIFPSKQKTDLEELKD-----KKLSSEELEYWKNLFRKGK