EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05982 alignment
(7 sequences with 411 aa)


Q9A2P7_CAUCR/49-365 PAVLFFALGLIAAMARSDLALPRDAAKTLSLILMLCIGFKGGVEARA---HGLDAGFLKAAGLGLALSFLLPLPAYALLRR-TGLDTLTAAATAAHYGSVSVVTFAAAQSYLSSIGQAPGGYMSAVLALMETPGLLTAIAI----------------------------------------------------------AALTTRGVA----TGQDADRAS---------------AGKLAHEVLLNAASVVLIGGFLIGLITGEAGGERLK---TFTGPVFQGVLCVFLLDLGVRAGRQLAAARGMNLGVLALGIVLPILGGVVALTLG-------WMA--GLPAGDLAALAVLAASASYIAAPAAMSMALPKADAGVYLTLSLGVTFPFNLTIGIPLLAIAAARLAG-G
Q9K663_BACHD/12-337 PVVLFFLLGIIAATFKSDLQFPKGLTEALSMYLLIAIGIKGGIELSH---YHLEA-VIGPVIGTIFLGMLIPVIVLMITRLFMKVDLKNSIALAATYGSTSIVTYGAAVSFLEKSGTTYEGFMNAMVVLKESPAILVSLLL----------------------------------------------------------LSIIERQQA----VPTTLSSKRVGIVSGHQGLI----DKEVLKESFFGKSIILLLGSLIIGLVVGERAIPMVQ---PLFIDLYQSVLILFLLYMGLTVGERLPEVKKHGIKLILFGVLTPILLGALGVLVG-------TLA--GLSVGGATLMGILAGSASYIAAPAALRTSVPEANPSIYLGLSLGVTFPFNLIFGIPLY-FEFAKLL--H
Q8YY66_ANASP/13-322 PPVLFFFLGMLAVFVKSDLEIPAPIPKALSLYLLFAIGFKGGVELIK---SGVTQEVVFTLLAAMLMACFVPIYTFFILK--LKLDTYDAAAIAATYGSISAVTFITASTFLSELGIAFDGYMVAALALMESPAIIVGLIL------------------------------------------------------------------------------VNLFTVDEKREFA----WSEVLQEAFLNSSVFLLVGSLFIGFLTGEHGWQVLE---PFTQGLFYGALTFFLLDMGLVAARRIKDLQKTGFFLILFAILIPILNAGIGLLIA-------KFI--GMPAGDSLLFAVLSASASYIAVPAAMRLTVPEANPSLYVSTALAVTFPFNIIVGIPLY-QYGINLFW-R
P71757_MYCTU/16-407 PLLLFFYFGFLIPIFKVRFEFPYVLYQGLTLYLLLAIGWHGGEELAKIKPSNVGA-IVGFMVVGFALNFVIGTLAYFLLSKLTAMRRVDRATVAGYYGSDSAGTFATCVAVLTSVGMAFDAYMPVMLAVMEIPGCLVALYL-VARLRHRGMNEAGYMADEPGYTTAAMIGAGPGTPARPAHSDSLTAQAERGIEEELE-LSLEKREHPNWDEDGVKDSGTN-------ASIF----SRELLQEVFLNPGLVLLFGGIVIGLISGLQGQKVLHDDDNFFVAAFQGVLCLFLLEMGMTASRKLKDLASAGSGFVFFGLLAPNLFATLGIIVA---HGYAYVTNNDFAPGTYVLFAVLCGAASYIAVPAVQRLAIPEASPTLPLAASLGLTFSYNVTIGIPLY-IEIARIVG-Q
Q8EAY3_SHEON/4-319 IVIAFFALGLLAGLVKSDLKVPPAIYETLSILLMLTLGLKGGMALHG---HTQNL-VFTELVAVVALGLLIPLALYPVLTRLVRLGRTDAISIAAHYGSVSAGTFAVVIAMVEKSGMTLRPETTLYLVLLELPAIVVMLWL----------------------------------------------------------HRYLSAKQP----LQATVPNTQ---------------QSSILHEALTSRGVVLLVGGVVIGWLYGPTGLAAIS---PVLLGGFKTLLALFLLEMGLVTAKVCLPLPLQQWRLLVFAAVTPFALAWCGIGVG-------LWL--ELPPGSILVLAGLSASASYIAAPAAIRAAIPEANIGLAMLASLGITFPVNVLIGLPLYQHWVMQIT--G
P73953_SYNY3/18-374 PTLAFLIGGMVIAALGTQLVIPEAISTIIVFMLLTKIGLTGGMAIRN---SNLTE-MLLPVAFSVILGILIVFIARFTLAKLPNVRTVDALATGGLFGAVSGSTMAAALTTLEESKISYEAWAGALYPFMDIPALVTAIVVANIYLNKRKRKSAAA-----------------------------------SIEESFSKQPVAAGDYG----DQTDYPRTRQEYLSQQEPEDNRVKIWPIIEESLQGPALSAMLLGLALGIFTKPESVYE-----GFYDPLFRGLLSILMLIMGMEAWSRIGELRKVAQWYVVYSLIAPIVHGFIAFGLGMIAH---YAT--GFSLGGVVVLAVIAASSSDISGPPTLRAGIPSANPSAYIGSSTAIGTPIAIGVCIPLF-IGLAQTLGAG
Q8YV47_ANASP/18-370 PTLGFLIGGMVIAALGSELIIPEAICQIIVFMLLTKIGLTGGIAIRN---SNLTE-MVLPAASAVAVGVLVVFIARYTLAKLPKVNTVDAIATGGLFGAVSGSTMAAALTLLEEQKIQYEAWAAALYPFMDIPALVTAIVVANIYLNKKKRSAA---------------------------------------GEYLSKQSVAAGEYP----DQQDYPSSRQEYLRKQQSADNRVKIWPIVKESLQGPALSAMLLGIALGLFTQPESVYK-----SFYDPLFRGLLSILMLVMGMEAWSRIGELRKVAQWYVVYSVVAPLVHGFIAFGLGMIAH---YAT--GFSLGGVVILAVIAASSSDISGPPTLRAGIPSANPSAYIGASTAIGTPIAIGLAIPLF-LGLAQAIGGR