EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05981 alignment
(10 sequences with 156 aa)


Q9JU13_NEIMA/7-155 LSAAVLLTACGSGETDKIGRASTVFNIL-GKNDRIEVEGFDDPDVQGVACYISYAKKGG---LKEMVNLEEDASDASVSCVQTASSISFDE---TAVRKPKEVFKHGASFAFKSRQIVRYYDPKRKTFAYLVYSDKIIQGSPKNSLSAVSCFGGGI
Q9HVM0_PSEAE/7-152 LLGGLLLLPALA-GAEEIGEVSTVFKWV-GPNDKIVVEAFDDPKVQGVTCYLSR---AKTGGVKGGLGLAEDRAEASIACRQVGPIQFSG-----ELKDGEEVFKQRTSLVFKSMQVVRFFDRKRNALVYLVYSDRVIEGSPQNAVTAIPLMPWPT
CREA_ECOLI/8-157 LSLSLIMLGPLA-HAEEIGSVDTVFKMI-GPDHKIVVEAFDDPDVKNVTCYVSRAK---TGGIKGGLGLAEDTSDAAISCQQVGPIELSDRIK-NGKAQGEVVFKKRTSLVFKSLQVVRFYDAKRNALAYLAYSDKVVEGSPKNAISAVPVMPWRQ
Q8XZD0_RALSO/21-165 ALLTAALLSTTA-SAEDIGSVNTNFRIT-GSD-KIVIEAFDDPLVGGVTCYVSRARTGGI---KGTLGVAEDVSEASVACRQVGEIRF-----VKPLPQQDDMFTQRLSLIFKTLHVVRTVDRKRNVLVYLTYSDKVISGSPKNSVTAVPIPAGQP
Q98KD2_RHILO/19-164 LAACVVLGAGSA-VAEEVGKVGV--DWV-GND--IIVEAIKDPKVDGVTCHVSYFDRSIIDRLHKG-NWFEDPSDSSISCRQTGPITIGD---IDMSEGGEEVFKQGISLIWKKQVVNRIYDKTNETLIYLSHSRQVQNGSAKMSVTTVPLYGQNV
Q92NP0_RHIME/12-157 GLTVSAAAVSPV-HAETVGQVGV--DWL-GND--IKIDAVSDPKVTGVTCHVTYFDRSVIDRLKNG-NWFEDPSNNSIACRQTGPIAIDD---IDLSKEGEEVFRSGLSLIWKNLLVTRIYDKANDTLIYLAHSRQLTDGSAKMSITTVPLYGQSV
Q8UDP5_AGRT5/11-156 AGLLALLPVTAA-HSEVVGKVGV--DWI-GND--IVIEAIADPKIKGVTCHVTYFDRGVIDRLKNG-NWFEDPSNNAISCSQTGPVEIGD---IDLSKGGEEVFRQGMSLIWKKLVVSRVYDKANDTLIYLVHARELKDGSAKMAISTVPLYNQQV
Q8FZQ9_BRUSU/12-157 LAPMLVFAASAA-PAEEVGKVGV--DWF-GND--IVVDAVHDPKVKGITCYLASFSRGMIDRLQKG-NWFENPSNASISCEQTGPIVIGD---IKLGKGGERVFAERTSLIWKKLVITRIYDKTNNTLLYLAHATQVQDGSAKTSLSTVPLYKGDV
Q8EF15_SHEON/12-153 LAVTLTGMMLSG-CGDDVGKVSL--GLFTTKD--VIIDAKQDPKIPGVTCHISRIEANL---------DFADPSDMGISCRQTGPISAADIAKIDKSKNGEVVFTESLSILFKTLKVRRIYDAPNQTLLYLSYSTKETNGSHKHALSTVPLFGSQA
Q8D7D6_VIBVU/7-149 TAVFATTALLSGCGGNEVGDVGL--GWFTLKD--IKITSLQDEVVTGVTCHIASIEANL---------SLSDPSDSSISCRQTGSITPEMIAKIDKSSSGEVVFKQSKSIFFKTMKVRRIYDQKNQTLLYLSYTTKETEGSFKHSLSTVPLWGTDA