EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05966 alignment
(6 sequences with 198 aa)


Q9Q8V7_9POXV/1-172 MSLQEN-DVEDSKDEGAAFIGSTIYGNKLKKKHL-I-KKVKCVSILLRVSIVTSIVSLMAITAILALQCSTCDVV-----------------KTSAHISSSINQY--ESECKGIVFDSACYTLHKEPKTFYEASEDCANQSAVLPFKT-LKDHWMWDYLEGTWGVDGYGIVELV---DLNTYDVSVEMRKYFCVKSFT
Q9Q8I0_9POXV/1-175 -MSLHANDADESKDEEAAFIGSTIYGKKLKKKHL-L-KKVRCIVILLRVSIVTSIVSLMAIAAMLALQCSNCEVITTSARISTYSSIA----------------HYEASTCKGIVFDASCYMFHKEPKTFYEAGADCANQSAVLPFKT-PKEHWMWDYLEGTWGVDGYGIVDSV---DLRTYDVSTEMRKYFCVKSFT
Q9DHJ1_YLDV/8-186 VNLDIEGDKLNSNENTNAFTGSTIYGSKLKKEKNTKSKKNKFFGLCIRISIIISILSLMAITITLSLQVNKYKSMVELNKDLNDASVSLSN-----------------AECRGLVYGNNCFIFNSEPKTFDEALSDCNTKNYFLPPTN-IMTSWLSDYLEDTWSEEGTSLLKSNIEFNSDDIDISTEMRKYFCVKSF-
Q91MP2_LSDV/6-196 PKSGTETDYDESN-NFTAFAGSTIYGYGLKSKKNIK-KKVKLINFCIKISIMASMVSLITITILLAFFNNTCEL---NQFKEHKPYFLKNPNPTTYSDDDTESELNVYRSCKGIVYSGYCYTFNSEPKSFNDAYDDCEKKNSELPSNN-LMNDWISDYLDGTWGEDGNVLFKEKNQ-ELETIDISDEMRSYYCVRSFF
Q8V3H7_SWPV/1-185 MSVEVNMENVKSEDNATSFSGSTIYGNKLKKKTN-K-SKSRCLAIGLRIAIITSLLSLIGIATTLALQYNKCKSVIEHNEQSYNNQDNITPDANYNIV-------KLYTGCQGIVYEYYCLRLVYEPLSFDDAVKSCMKNKGNLPSSD-LMKTWLSDYLDGTWGEEGRGLSKEKT---ILEVDISTELRSHFCLESFY
O57236_9POXV/1-185 MMTPEN------DEEQTSVFSATVYRDKIQGK----NKRKRVIGLCIRISMVISLLSMITMSAFLIVRLNQCMSANEAAITDAAVAVAAAS-STHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYQLFSDAKANCTAESSTLPNKSDVLTTWLIDYVKDTWGSDGNPITKTTSDY--QDSDVSQEVRKYFCVKTMN