EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05942 alignment
(25 sequences with 160 aa)


Q977D0_SULTO/5-148 LDY---KKNPKEYVYAKVYESLVEARLALEMLKRGLLKNASAKAFLSVKSAVSALLVSKLNEILK----------GKDEKERSWYENVGYSAPTTGLIGIAKEFKKLG-IDIENVVKTALLLHKFSYNGFDPNFV--DYRNEDEVADDIREVIEWVLNID
Q8ZY22_PYRAE/6-147 DYKSRP----REYIVARFNEAAAEANLAEEMLRRELYQNAANKAFMALKALTSAIVASELCNLKR------------DEKRREWYEKVGYAAPTTGLIKIAKDLEALGYKGIEAAVKTALLLHRLAYNGFDPNFV--DYLDTDEVVSDIKQVLDFVKTTI
Q973K2_SULTO/11-156 EGTVPQVKNLQSYINFKLEEAIVELNLAIELLKRGYSRNASQKAFMAWKAIVSVLVSMNLDKMP------------KDEKEREWYYKAGFLAPTTGLNGIARRLEELGYADVIGTNSLALKLHRYAYNGIYRG--TSDYADRKDAIEDLKILIRKMIRML
Q96XD8_SULTO/5-147 IPAIE--KHRNAYIKIRVIESLDELALALKLLKEGFSRNSASKIFLSWKALISALAVMNLEKMP------------RDEKEKEWYYKSGFLAPTTGLKGISQRLEELGY-KVNHLTSTALELHRYAYNGLYKGA--SDYSDREEAVRDILQLAKDILTNV
Q96X99_SULTO/5-154 LPKFI--REPEKYSRLRLLESLQELYLSVEMLKAGYSRNSASKLFLSWKALLSSLVVANFNKIVE-----KKKKEGK-EDDVKWYLRIGYSAPTTGLMGISRDLEDLGFKGLVTLTTAMLGIHRYAYNGLDED--ISPFHSRNDAIISIKELVRAEVEII
Q974D4_SULTO/9-160 LTK--PWIDMKKYQEDRLKEAWYEADLAERLMNDGLLRNAAGKAYQAVKAYVAAVAVNFRPQLAKYFPGKKKISPS---KEVEKVDWIIAIMPSSKLRKVVAII---GDDQLRLLTEIALDLHEFQYNGFDKDSEVSRYDSEEFVKKDILYIVNFIKSKV
Q8ZZZ5_PYRAE/4-155 LSK--PWVDLEKYRRDRLKEALYEAELAEEFLKNGLIRNAAGKAFQAVKAYLAAVAAAHRDRIVAAFPGRRRISPA---KVVERGEWIIAVMPTSRMREVAAIV---GDRELRLMVELALDLHEFQYNGLDGDAEVSRYASEEMVRRDIEEVVAFIKRAA
Q8ZUB5_PYRAE/4-154 LAK--PWHDVDKYRRDRLKEALYEAELAEEFLKNGLYKNAAGKAFQAVKAYLAAVAAEKREALAQYYPGERTVQK----KKVAVVDLLIAYMPTTRMKEVAARL---GDRELELVVEKALDLHQFQYNGLDREGVFSRYTTLEIVERDIKDVVEFVKRRV
Q970N9_SULTO/21-175 VTK--PWIDDKKYKQDRLIEAKYEAELARRFLEDGLFRNAAGKAFQAWKALLASLSVDYIQELSKYFKGKRKMRDGR---VVNYVEWIIALMPTSKMSNVAQILDNLLGNNIEAYTDIAIKLHEFQYNGLDKSGEISRYTSIEFVKMDLEKLLKAIEKFL
Q8ZYD7_PYRAE/3-157 IVY--PWRDIRRYVEIRISEALVEADLALRFLEEGLHRNAAGKAFQAWKAALAAAAGLARDVVASKFKGRVVTREG---AEVELADWLIALMPTGKMWEIARVLKGVYGDEITLLTAMALNLHEVQYNGLDEGGLLSKYSRVDQVEEDVRELAERVKKFV
Q8ZUA9_PYRAE/4-158 FVP--PWRDLEGYVQLRLEEASAEAELALKFLAQGLHRNAAGKAFQGWKALLAAAAAKNREVLTSRYPGVIRDKTH---KARSRADIIIALMPTTKMREVAGLLVGIYGWELVYLTDLALSLHEFQYNGLDAVGIASRYSHISDVERDIRHLSEKIKEWA
Q8ZX97_PYRAE/3-157 VVH--PWRDLRKYVEIRLEEAEAELRLAERFLEEGLYRNAAGKAFQAWKSLMAAIGAMYRDVLAKHFPGVVKTRDG---KTVPRVDWVLAYMPTTRLREVAIRLRGVAEFDIVSLTDLALNLHEFQYNGVDKEAVLSRYTALDLAVSDLNYFIEKCKEVL
Q972P3_SULTO/4-154 LPK--PWFDIEGYKRTRIKEAEFEANIAEEFVKEGLLRNAAGKAFQAWKALLGAMLVDIRGELLKKYPGKKKLRGR---KIVEFADWLIAIIPTSYMEELSLLL---G-KDVNLVTKLALALHEYQYNGADKDTILSPFRTDDIAKENILILIDEIRSRL
Q96Z15_SULTO/13-163 LPK--PWFDLQAYKKTRLLEAKYEAEIARKFLDEGLIRNAAGKTYQAWKALVAGIAVDHRDKLKGLFTGKIKIKGG---KMIEKVDWVIAIMPSTALKIVSQVI---GG-EISLYTNLALLIHQYQYNGPDKEGIVSPYTNDEIAKNDIILLLNEIEKIL
Q8ZY27_PYRAE/4-155 LPK--PWFDLRRYKEVRLREAVYEAEISEEFLEEGLVRNAAGKAFQSWKAVVAAHSVDKLEELKKAFPGRKRLRGSR--RVVEKAMWVIAIMPTSALKKVAQII---GG-EVDLYTNLALLLHEYQYNGPDPEGILSIYPDDDSAAKDVRKLIEKARQLA
Q8ZZE3_PYRAE/3-156 LAK--PWSDLNGYIEARRKETLFEAELAREFLRQGLTRNAAGKAYQAWKATIAVLAAKKLGYLSSVYRWVKRIKN----KRVGMAEWHVAYMPSTRLREVARLLAEAYGIEVFLATELALSLHEYQFNGPDKELVLSRYKSDDEAARDVELLLKYVEVFL
Q8ZUE8_PYRAE/3-157 LEK--PWRDEIGYLKARLLEAKYEAELAKGFLEQGLYRNAAGKAYQAWKALLAALALREREALKNVFKDVKRLRNG---KRLSEADWVVAFMPSTRIRHVAQILARKYGDELLMYTDVALNLHEYQYNGPDKEGIFSRYFNDDAAREDVERLLKGVEKFR
Q8ZYC2_PYRAE/6-159 LSK--PWRDLEKYREARLREARVEIDLALEFLEDGLIRIAAGKAFQAWKAYLASRLAEKREALKELFPGSRRIRAGEEEIEVEDVDVVIALVPTTQMIKLSTVV---GE-DAVEFTSLALDLHRYQYNGPDPEGFFSEVPDDRTAALLICRMAFRLAGDT
Q8ZUL7_PYRAE/3-141 VVVEKPWRNLQEYIKARLEEAAVELQLALILMGEGYTRNAAGKLFQAFKSYLAAAAGEKREELAARLRD---------------VDKLIAYMPTRALVKISTLL------GLEREARVALALRQYQYNGPDPEGITSLYPDRESAKRDFCWLAKRLIELT
Q96ZS9_SULTO/5-147 LYKV-----DEDYVEARVIECLSDLLLSIALWKDGYTRNSAGKAFSAVKALLSALIVVNEEKLLSLAKDDKER---------EWIKKKAHTVPTHSMYALAQMLKEIG-IDVIQLVNYALDLHEYQYNGFEPG--FSKYSRKEDVLKDLTTVIKETEKAV
Q8ZZ61_PYRAE/6-155 RPL--PKPSSVDYASARVLEALVEGRLAVEFLERGLVRNAAGKAFQAWRALLAALLRLELDKLMNIAKTEEERRW--------LAERAVPRVPTTKMVSLSYMLEEAGHWGLSAWTALALDLHDYQYHGPDPDMALSKYRSKEEAAQAVLKLVTEIAKRA
Q8ZZ16_PYRAE/5-153 LERPLPKPSSEDYATARLLEALVEARLALEFLSRGLVRNAAGKAFQAWRALLAALLRLELDKLLKAAKTDEERKW-----------LVERAVPTTRMKLLSQMLEGVGHVGIVAWTNTALLLHEYQYHGPDPDLAASMYRNKEEAARDVELLVAELARRA
Q8ZYZ9_PYRAE/6-157 LEKPLPKPSDEGYVSARLLEALAEGGLALRFLKEGLVRNAAGKAFQAWRALVAALLRLELDRLKAVVKSDEERKW--------LETTAVPRVPTSRIKALSQMLEAIGYDDVSLWTALSLNLHDYQYHGPDPDMAMSKYSSRVEAAYDVVKLVGGVVKYA
Q8ZSM7_PYRAE/5-156 LEKPLPKPSTEGYVSARLLEALVEGRLALEFLERGLVRNAAGKAFQAWRAFLAALLRLELEKLKAVVKTEDERRW--------LESTAVPRVPTGRIKALSQMLEEVGHGGISFGTDKALDLHDYQYHGPDPDMALSKYRNREEAARDVVLLLKELAKRV
Q973N5_SULTO/6-150 VWE----RDIRKYGELRVEESIDEALIAIELLRQGKFRNSAVRAFLAFKAFVSGIISINHLSFSSNLEEKER----------KFFYKIGFTAPSNRLLYYASILEK-DLPGITDLAKQAMSLHVFSYVGYDRAGEYSPITSKEDAKKWILDFIIALANFI