EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05940 alignment
(14 sequences with 397 aa)


Q9KPN6_VIBCH/33-409 IPAVLRLGFRPFFLLGSIYAVIAILAWVWMFQAGQPQL--LQVPALWWHVHEMLFGFAMAIVAGFLLTAVQNWTG.ITGTKSHRLAGIVALWLMVRILFWLPV--PLWLTSSIEALFLLAVAYEVGLRVVKAKGWRNLFFIPLFLLAIAANFASYA-TIKGMPPFPSSAvWQAMLWWFMLLLSVMGGRVIPFFTARRFQFTKA----EPILALDVIANGSLLALFVLSFFPLT---MAQLGQPLMLVAGVAQLIRFLRWQPWRTFSEPLVWSLHAAYLCIPLSLLLRGG----VSNAWLNHNLLHLFAIGALSGLVLSMIARVTMGHTGRAIYQGP.NMQWAFIAL-LLAAVVRGVGVGLLP-QQLLIWVNLSAALWVIAFALFVLRFGAMLLKPRV
Q8DBN2_VIBVU/5-376 IPAWLRLGFRPFFLLGSVYAIIAIAVWVWIFQTGQPTQ--LQVPGLWWHVHEMLFGFAMAIVAGFLLTAVQNWTG.INGTKHYRLALLVALWLLPRILLWTPT--PLWLTSSIEALFLALVAFEIGSRVVQAKGWRNLFFVPLFLLAIGANFASYA-TIKGMPPFTSSAvWQAMLWWFTLLLSVMGARVIPFFTARRFNFEKAN----PIVWLDWAANLPLVMLFLLSFFPV---TMAQLGQPLMVIAGVAQLVRFIRWKPWLTLSEPLVWSLHAAYLCLPLSLLLRGLLD----NPFASHNLIHLFAIGALAGLILAMIARVTMGHTGRMIYQGP.NMSLAFGAL-FLAALVRSFGVIFAP-AQLFIWIDISAALWVFAFTLFAGSLVICS-----
Q9I0H6_PSEAE/12-392 IPPIWRLGFRPFFLGGALFAVLAIALWLAALAGLWSGWQ-PVGGWLAWHRHEMLFGFGVAIIAGFLLTAVQTWTG.VPGLQGKPLALLAGLWLAARLAWLFDA--PLALLLVLQLSFLPLLAWAIGRSLWRVRQKRNYPVVGLLLLLTLADALVLLGLFEGNDDWQRRA.SIAALWLIAGMMNLIGGRVIPFFTQRGLGRQQQVPA---IAWLDNGILLGCVLVALLTAAGVTTQPTPWLAGLF-AALGGAQLWRLWRWRDRGIWQVPLLWSLHLAYFWIAVAPLGMALWS--LGLALAPSQALHALAVGGMGGLILAMLARVTLGHTGRALQPPA.AMPWAFALL-NLGCAARVFLPSLLP---ANWALPLAGGLWALAFLLFAWFYAPMLCRPRV
P95556_PSEST/12-391 IAPIWRLAFRPFFLAGSLYALLAIPLWVAAWTGLWPGFQ-PTGGWLAWHRHEMLFGFAMAIVAGFLLTAVQTWTG.QTAPSGNRLVGLAAVWLAARLGWLFGL--PAAWLAPLDLLFLVALVWMMAQMLWAVRQKRNYPIVVVLSLMLGADVLILTGLLQGNDALQRQG.VLAGLWLVAALMALIGGRVIPFFTQRGLGKVDAVK---PWVWLDVALLVGTGVIALLHAFGVAMRPQPLLGLLF-VAIGVGHLLRLMRWYDKGIWKVGLLWSLHVAMLWLVVAAFGLALWH--FGLLAQSSPSLHALSVGSMSGLILAMIARVTLGHTGRPLQLPA.GIIGAFVLF-NLGTAARVFLSVAWP----VGGLWLAAVCWTLAFALYVWRYAPMLVAARV
Q8EDE7_SHEON/13-385 KLPLFRLGFRPFFLFASLFSLLSLGIWGGFLAGNALLP--NSINPLWWHGHEMIFGFVCAVVAGFLLTAVQNWTG.QPGLKGLPLAGLFIVWLLPRLLFILPLDIPFVITMIIDLLFLPLTAVLLSISVIKVRQWRNFVFIPILSLLTLFNGLSYYGLISDQLHWTHNG.LYAAIILIAVIVALLGGRVIPFFTERAAQWQK--PMPIPLLEF-------LSFASLLALIASLFLTQLLLTRSLAGIAGCVLLLRWSRWGWHASWSVPLLWSLHLSYLCIPIGL---GLIA----TGLPLSVGMHAITVGGLGGMILAMMSRVSLGHTGRPLKPAR.PMALAFGLI-LFAALLRVLAGL--PSAWFIELMLAAIICWMLAFGCFCYCYAPMLCRVRV
Q93SI1_BRAJA/11-390 GWPLFANSFRPFFLLAAIQAGLSILAWLPMFYGELSVT--SAFAPRDWHVHEMLYGFLPAVITGFLFTAIPNWTG.RLPIQGTSLGALLAVWLAGRLAVTLSAEVGWAFALVVDAAFLALVVAAATREIIAGGNWRNLPVVILVLVLLTGNVGFHLEAHYAGAADVS--.IRVGIGVVVLLIALIGGRIIPSFTRNWLVKFNPGRLPVPFGRFDGAVIA-LSALALISW---IVAPLNVVTGAAMALVGVLHLVRLARWAGDRTSRERLLLILHVGYVFVPLGFLLHALAV--FGA-LPPSAGIHAWMAGAAGTMTLAVMTRASLGHTGQTLTASP.ATQGIYVAI-IAAALARVAAVVW--PAHADALLHIAACGWVVAFLGFAIAFGPLLAGSSR
Q936J2_RHOSH/11-390 GPALLSYGFRPFFLLSALFAAGAVPVWLAVWSGRIGLA--GPFSPIDWHIHEMLFGYTSAVIAGFLFTAIPNWTG.RMPRRGLPLAALAALWIAGRFAVAGAFGTDPLLVLVIDAGFLLAVTLMAVIEIAAGKNWKNLMVVGPVGLYLAANVLFHLEAMQQGESDIG--.RPLGFATVTFLIMLIGGRIIPSFTRNWLAKGGPGPLPVPFGRFDGASLL-VAVGALLCW---TLAPDAILTAALLALAAALHVVRLVRWRGHLVWRSPLLLMLHVAYGFLPLGLAATAAAA--VGW-ASAPAGLHLLGIGAIGGMTLAVMMRASLGHTGRPLEAGR.ALSAGFACI-VAAAAARTVLAAT--DIGGIDGYSLAAAFWTMGFAIYVGRIGPCLLRPSL
Q92Z28_RHIME/21-400 GPVLFSYGFRPFFLGAAVWAVVAMTLWIAALVGHLEVA--GSYGAHAWHAHEMLFGFAPAVLAGFLLTAVPNWTG.RLPVSGWPLAGLFTLWLAGRAALLSPDVIGIPPAAAIDGLFLPALLLICAREVIAGRKWKDLKVLGGLLALSLANACFHFAVVTGDHVHIA--.MRLGISAYVALVTIIGGRILPSFTRNWLNRAGRTEFPVPYNHFDTVAIL-AGIAALGAW---TLAPDHPVTAVPAFAAALLHTVRLARWRGWRTWPEMLLVILHVAYAFVPLGFAATGIGA--LGF-VEELSVMHVLTVGAIAAMMLAVMTRASRGHTGYPLTASR.LTAASYAAV-VLSALLRPLAEML--PEIAPTLYAVSGSAWILAFALFCIEYGPILVRKRR
Q8U7R6_AGRT5/41-420 GPVIFSYGFRPFFLGGALWAIVAMVLWIAALSGFIDIG--GDYGAPNWHAHEMLFGFASAVLAGFLLTAVPNWTG.RLPVSGKPLVWLFALWCAGRLLLLVPDQVGVVTAAAVDGLFLPALLAICAREVIAGRKWKDLKVLGGLLALSVANIVFHVAAIGGDHSQMA--.TRLAVSAYTVLVIIVGGRIVPSFTRNWLNRFGRTDFPVPYNGFDTAAIL-TGIVALAVW---TIEPESMLAVSTALLAAFMHAVRLIRWRGWTTRPEQVLVVLHVAYAFIPVGFIAIALAA--LDV-MDTRSVLHIFTVGVIGCMMLAVMTRASLGHTGRKLAASR.LTIAAYVSL-IACALLRPAAEFL--PGVMMHLYGCSALLWIVGFGLFCVEYGPILMRERK
Q8YBD6_BRUME/30-409 GPVILSYGFRPFFLGGAIWAVMAMLLWILSLTIGLPLG--GSYGALNWHAHEMVFGFSSAVLAGFLLTAVPNWTG.RLPVSGGPLAVLCGVWLAGRLAFLAPDLVHIDVAVAIESLFLPFLLFIAAREIIAGHHWRNLKVLGGIAGVMIANFAFHYLVLTDGDVTFA--.NRIGVSAYVILVTLIGGRIIPSFTRNWLNRMGKTRFPVPFNRYDALTLI-VGVVACLSW---IFLPESSLTAVLALIAAAFHLVRLYRWRGWTVAREKLLVILHVAYLFVPGGFVAIALSA--LDR-LNPFSALHVMTVGAIGAMMLAVMTRATRGHTGRELVASP.MTQIAYVCI-IAAAVIRPFAEIM--PNFFHTLLAASALLWMLAFGLFVVEYGPMLLRKRR
Q8XTZ6_RALSO/23-398 GLPVFALGFRPFYLLAAAFAVIGMALWAALLLGGFSAAHGPTLPPLFWHAHEMVFGVAAAVVVGFLFTAGKNWTG.LQTPQGPLLAALAAVWLAARILMWTGP---GPLAVAVDVAFLPLCGVLFLRILRRAANARNYGLAAALLILGAVNAGFHFALMAGAPLLALRC.VDAAAGLVAMFVTVIGGRVIPMFSTNAIPGIRIRR----AAWAERAIV-PLTLAAVIVL---ALPVSGVVPAAVFASAAVAQVVRWVGWNSVRTLRTPIVAILHVAYGFLPLGFGLLAVSA--LGG-IDRSTALHALTVGAIGGAIVAMITRTALGHTGRPLRAGH.AERLAYAAI-ALAALVRVVGPLL--LPRG-IWIGVSSAGWVVAFAVYLWKYTPWLLAPRV
Q9JT11_NEIMA/21-395 KHPVWAMAFRPFYSLAALYGALSVLLWGFGYTGTHEL------SGFYWHAHEMIWGYAGLVVIAFLLTAVATWTG.QPPTRGGVLVGLTIFWLAARIAAFIPGW-GASASGILGTLFFWYGAVCMALPVIRSQNQRNYVAVFALFVLGGTHAAFHVQLHNGNLGGLLSG.LQSGLVMVSGFIGLIGTRIISFFTSKRLNVP---QIPSPKWVAQASLWLPMLTAMLMAH-----GVMPWLSAAFAFAAGVIFTVQVYRWWYKPVLKEPMLWILFAGYLFTGLGLIAVGASY--FKP-AFLNLGVHLIGVGGIGVLTLGMMARTALGHTGNPIYPPPkAVPVAFWLM-MAATAVRMVAVFSS-GTAYTHSIRTSSVLFALALLVYAWKYIPWLIRPRS
Q92Z46_RHIME/1-365 MSSIWRAPYRPLFFLAGLWALIVPIVWLL--------PEQLVPDRVEWHSRELLFGMGGAAAGGYLLTALPAWTRgAVPPAATVIA--TCLWCAARLTGAFSDHLPLIAAAIGVSGYFAFLTAMLMRGVVVSRAWARCWAPLGTGAL---GVNAFVSIADGPSPTP---.-----LLFAALIVVVGGRAVPAFTGSWLYRTAGGKSLRNRRELSHLAVAGILIATFLHGDW-----SPTLPGLLLLFSGAMLLWQMSEWRSLGTRGYPALFILHVAFAWTPTALLLGGLSATISGH-VPADDALHALTMGAMGTMIAAFMMRPAMVRDGESLILGG.TMAGAFSLV-SLSALLRTSGGWL--DADHFEPEAAAAICWMAGWTLFLIAYLPAMSGPVP
Q8U7P5_AGRT5/3-388 QPPILSEALRLFFPLAALHGAVWPFLWIVIGGYALPFA--NAVPPSQWHAHEMIFGTYGMALAGFLGSAVPEWTD.TKAAAGRTLLCLAGLWLPGRLIGFVGADTWSLLAGFFDLAFLLALSVLIGKAMLVRRTTKHLAFLVWLILFAAAETGVRYAWWMGDLEFAVRC.LEAALCIFIVLFSLSAARINVVVINLALDPSGETTPYRPHPGRQHMA-GAMVTLYMAAK---LLFPESDVCAWLALAAGAAFFDRLAEWFIGRAVFRTEVLLLALGNAFAGAGFLALGATR--LGFSVTSAAGLHLLSVGALGCAIMAVFIIAGLRHTGRDLKHLP.WQAHAAAALMVMAGLTRILPEFDVAAVLSPYHHGLSAILWAASFGIWLQGFLPFMRAPGT