EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05931 alignment
(19 sequences with 45 aa)


Q8VT12_9STAP/1-45 MNLLNSFFSFFAKFFELIGTVAGVNPCGGWFDEPEVPEELTKLSE
Q8VT00_STACP/4-48 DALFNLVLKFFTIIFEFIGFVAGANPCALYYDEPEVPDELSKLYE
O68160_STAEP/2-46 EIIFNLFIKFFTTILEFIGTVAGDSVCASYFDEPEVPEELTKLYE
Q8VSX3_STAEP/2-46 NLLGGLLLKLFSNFMAVIGNAAKYNPCASYLDEPQVPEELTKLDE
Q8VSZ7_9STAP/2-46 MQIINLLFKVITAVFEKIGFIAGYSTCSYYFDEPEVPKELLEIYK
Q8VSZ4_9STAP/4-48 MQIFDLLFKVISFIFEKIGFLAGYRTCNTYFDEPEVPKELFETYQ
Q8VSZ1_STACA/1-45 MDILNGIFKFFAFIFEQIGNIAKYNPCVGYFDEPEVPSELLDEQK
Q8VSX1_STASI/1-45 MDLLNGIFKLFAFIFEKIGNLAKYNPCLGFLDEPTVPKELLEEDK
Q8VSW9_STASI/1-45 MELLNGIFKLFAFIFEKIGNLAKYYPCFGYFDESEVPQELLDEDK
Q54338_STALU/2-46 NLLSGLFTKGISAIFEFIGNFSAQDICNAYFDEPEVPQELIDLQR
Q8VSY8_9STAP/1-45 MHIFESIINLFVKFFSVLGAVSGGKVCSAYFDEPEVPKEITDLYK
Q8VSY2_STAGA/1-45 MNILDSLLNLATKFFSALGASVGARPCGGFFDEPEVPAEITELHK
Q8VSW3_STAXY/1-45 MNIFESILNLFAKFFSVLGVMAGAKPCGGFFDEPEVPSEITKLYE
Q8VSY5_9STAP/1-45 MNIFESILTVFAKFFAFIGTISSVKPCTGFADEPEIPKELTDLYK
Q8VSX9_STAIN/1-45 MRILEVLFNLITNLFQSIGTFARIPTSTGFFDEPEIPAELLEEEK
Q8VT06_9STAP/1-45 MKLLDLLLSSTTSFLQMVGNRSKTKTCTVLYDEPEVPKELIQELE
Q53643_STAAU/2-46 NTLFNLFFDFITGILKNIGNIAAYSTCDFIMDEVEVPKELTQLHE
O33589_STAAU/2-46 KKLLNKVIELLVDFFNSIGYRAAYINCDFLLDEAEVPKELTQLHE
O33586_STAAU/2-46 NTLVNMFFDFIIKLAKAIGIVGGVNACSSLFDEPKVPAELTNLYD