EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05902 alignment
(5 sequences with 116 aa)


Q9JMB2_RAT/843-956 KLETSTKEVPVVHTETKTITYESSQVD.PGADLEPGVLMSAQTITSETTSTTTTTHITKTVKGGISETRIEKRIVITGDAD.IDHDQALAQAIKEAKEQHPDMSVTKVVVHKETEI
41_HUMAN/747-861 KSEIPTKDVPIVHTETKTITYEAAQTDdNSGDLDPGVLLTAQTITSETPSSTTTTKITKTVKGGISETRIEKRIVITGDAD.IDHDQVLVQAIKEAKEQHPDMSVTKVVVHQETEI
E41L2_HUMAN/886-999 RTEISTKEVPIVQTETKTITYESPQID.GGAGGDSGTLLTAQTITSESVSTTTTTHITKTVKGGISETRIEKRIVITGDGD.IDHDQALAQAIREAREQHPDMSVTRVVVHKETEL
Q8MLI7_DROME/622-699 GEIISTQTVSSKTRTVETITY------.------------------------------KTERDGIVETRVEQKITIQSDGDpIDHDKALAEAIQEATAMNPDMTVEKIEIQQQTQ-
O18673_CAEEL/4453-4530 GEYVSSKSVTQGNRTIETITY------.------------------------------KTEKDGIVETHVEHRVTIHSDGD.IDHDAELSQAILEATQMNPDMVVEKIEVRQETTQ