EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05896 alignment
(10 sequences with 469 aa)


NQRA_NEIMA/1-447 MIKIKKGLNLPIAGRPEQVI-YDGPVITE-VALLGEEYAGMRPSMKVKEGDAVKKGQVLFEDKKNPGVVFTAPVSGKIAAIHRGEKRVLQSVVIAVEGNDEIEFERYAPEALANLSGEEVRRNLIQSGLWTALRTRPFSKIPAVDAEPFAIFVNAMDTNPLAADPVVVIKEAAE------DFRRGLLVLSRLTERK..IHVCKAAGADVPSEN.AANI-ETHEFGGPHPAGLSGTHIHFIEPVGANK-TVWTINYQDVIAIGRLFATGRLNTERVIALGGSQV--NKPRLLRTVLGAKVSQITAGELV--DADNRVISGSVLNGAITQGAH-DYLGRYHNQISVIEEGRS-KELFGWVAPQPDKYSITRTTLGHFL.KNK--LFKFTTAVNGGDRAMVPIGTYERVMPLDILPTLLLRDLIVGDTDSAQALGCLELDEEDLALCSFVCPGKYEYGPLLRKVLETIEKEG
Q44130_ACTPL/1-449 MITIKKGLDLPIAGTPAQVI-HNGNTVNE-VAMLGEEYVGMRPSMKVREGDVVKKGQVLFEDKKNPGVVFTAPASGTVVTINRGEKRVLQSVVIKVEGDEQITFTRYEAAQLASLSAEQVKQNLIESGLWTAFRTRPFSKVPALDAIPSSIFVNAMDTNPLAADPEVVLKEYET------DFKDGLTVLTRLFNGQkpVYLCKDADSNIPLSPaIEGI-TIKSFSGVHPAGLVGTHIHFVDPVGATK-QVWHLNYQDVIAIGKLFTTGELFTDRIISLAGPQV--KNPRLVRTRLGANLSQLTANELN--AGENRVISGSVLSGATAAGPV-DYLGRYALQVSVLAEGRE-KELFGWIMPGSDKFSITRTVLGHFG.K-K--LFNFTTAVHGGERAMVPIGAYERVMPLDIIPTLLLRDLAAGDTDSAQNLGCLELDEEDLALCTYVCPGKNNYGPMLRAALEKIEKEG
NQRA_PASMU/1-446 MITIKKGLNLPISGSPEQVI-RDGNAITE-VALLGEEYVGMRPSMKVREGDVVKKGQVLFEDKKNPGVVFTAPASGTVTAIHRGAKRVLQSVVIKIEGNEQITFEKYTTEQLNQLTSEQVRQNLQASGLWTALRTRPFSKVPAVDATPVSIFVNAMDTNPLCADPQVIVQQSAQ------AFEAGLTVLSRLHEGK..VYLCKAANASIPSPS.IANL-DVKEFAGPHPAGLSGTHIHFIDPVSATK-FVWYINYQDVIAVGKLFTTGELDVSRVVSLAGPQV--KNPRLVRTVLGANLSQLTANEVK--DGENRVISGSVLSGAKAAGPV-DYLGRYALQVSVLEEGRE-KEFLGWIMPGANKYSLSRTVLGHFS.K-K--LFNFTTALNGGERAMVPIGAYERVMPLDIIPTLLLRDLAAGDTDSAQALGCLELDEEDLALCTFVCPGKNEYGPLLRQALDKIEKEG
NQRA_HAEIN/1-447 MITIKKGLDLPIAGKPAQVI-HSGNAVNQ-VAILGEEYVGMRPSMKVREGDVVKKGQVLFEDKKNPGVIFTAPASGTITAINRGEKRVLQSVVINVEGDEKITFAKYSTEQLNTLSSEQVKQNLIESGLWTALRTRPFSKVPSIESEASSIFVNAMDTNPLAADPSVVLKEYSQ------DFTNGLTVLSRLFPSK.pLHLCKAGDSNIPTAD.LENL-QIHDFTGVHPAGLVGTHIHFIDPVGIQK-TVWHINYQDVIAVGKLFTTGELYSERVISLAGPQV--KEPRLVRTTIGANLSQLTQNELS--AGKNRVISGSVLCGQIAKDSH-DYLGRYALQVSVIAEGNE-KEFFGWIMPQANKYSVTRTVLGHFS.K-K--LFNFTTSENGGERAMVPIGSYERVMPLDILPTLLLRDLIVGDTDGAQELGCLELDEEDLALCSFVCPGKYEYGSILRQVLDKIEKEG
NQRA_YERPE/1-447 MIKIKKGLDLPIAGAPVQTI-QDGPAIHH-VALLGEEYVGMRPSMLVQEGDQVKKGQALFEDKKNPGVLFTAPASGKISAINRGERRVLQSVVIEVEGDEQIPFEHYAAEELNQLSDEQVQHHLLTSGLWTALRTRPFSKTPVPGSRPRAIFISAMDTQPLAADPQVIIATESE------AFNHGLTVLTRLTDGK..VHVCHAAGQAVTRHT.NTQV-TYNEFSGPHPAGLVGTHIHFLEPVSQTK-MVWHVGYQDVIAIGKLFTRGELCTDRIVALAGPQV--NQPILLRTRLGASLSELTAGKLK--EGDNRIISGSVLSGTAFSATH-GYLGRFHQQVSVIREGRE-KELFGWVMPGRDKYSITRTTLGHFF.KRK--LFAFSTDMHGGERAMVPIGNYERVMPLDILATHLLRDLLAGDTDSAQALGCLELDEEDLALCTFVCPGKYEYGPVLRDILTQIEQEG
NQRA_VIBAL/1-446 MITIKKGLDLPIAGTPSQVI-NDGKTIKK-VALLGEEYVGMRPTMHVRVGDEVKKAQVLFEDKKNPGVKFTAPAAGKVIEVNRGAKRVLQSVVIEVAGEEQVTFDKFEAAQLSGLDREVIKTQLVDSGLWTALRTRPFSKVPAIESSTKAIFVTAMDTNPLAAKPELIINEQQE------AFIAGLDILSALTEGK..VYVCKS-GTSLPRSS.QSNV-EEHVFDGPHPAGLAGTHMHFLYPVNAEN-VAWSINYQDVIAFGKLFLTGELYTDRVVSLAGPVV--NNPRLVRTVIGASLDDLTDNELM--PGEVRVISGSVLTGTHATGPH-AYLGRYHQQVSVLREGRE-KELFGWAMPGKNKFSVTRSFLGHVF.KGQ--LFNMTTTTNGSDRSMVPIGNYERVMPLDMEPTLLLRDLCAGDTDSAQALGALELDEEDLALCTFVCPGKYEYGTLLRECLDTIEKEG
NQRA_PSEAE/1-445 MIKIKRGLDLPISGAPEQRI-EAARPVRS-VALIGFDYHGMKPTMAVQVGDRVKLGQVLFTDKKNPSVSYTAPGAGVVSAIHRGEKRVLQSVVIDLDGDEQLEFARYPADKLATLSAEQVRDNLLQSGLWTALRTRPFSKVPDPESSPSSIFVTAIDTQPLAADPQVVIAEQGE------AFQAGLTVLGRLA--R..VFLCKAEGVSLPGEA.LSGV-TAQAFSGPHPAGLPGTHIHFLDPVGAGK-SVWNLNYQDVIAIGKLFTTGQLWTERVIALAGPVV--EKPRLVRTRLGANLDELAAGQLQ--PGNNRLISGSVLGGRTAHGAY-AYLGRYHLQLSCLKEGDQ-REFLHYLRAGVEKHSLLNVFVSRLL.GGK--RFAFTTSTNGSPRAMVPVGNYEAVMPLDILPTQLLRYLIVGDTEMAQKLGALELDEEDLALCSYVCAGKYEYGPILRDNLARIEQEG
Q9X6S0_PORGI/4-450 VIKTKKGLALNLKGKPLPEMLAEPAQSPT-YAVVPDDFEGVIPKVTARPGDKVRAGSALMHHKAYPEMKFTSPVSGEVIAVNRGAKRKVLSIEVKPDGLNE--YESFPVGDPSALSAEQIKELLLSSGMWGFIKQRPYDIVATPDIAPRDIYITANFTAPLAPDFDFIVRGEER------ALQTAIDALAKLTTGK..VYVGLKPGSSLGLHN.----AEIVEVHGPHPAGNVGVLINHTKPINRGE-TVWTLKATDLIVIGRFLLTGKADFTRMIAMTGSDA--AAHGYVRIMPGCNVFASFPGRLTIKESHERVIDGNVLTGKKLCEKE-PFLSARCDQITVIPEGDDVDELFGWAAPRLDQYSMSRAYFSWLQgKNK--EYVLDARIKGGERAMIMSNEYDRVFPMDIYPEYLLKAIIAFDIDKMEDLGIYEVAPEDFATCEFVDTSKIELQRIVREGLDMLYKEM
NQRA_CHLMU/2-460 KIIVSRGLDLSLKGAPKESG-FCGKVDPAFVSVDLRPFAPLPLGVKVSPGDQITAGSPLAEYKSFPGVFITSSVDGEVIEIRRGSKRALLDIVIKKKPGVSQTKFSY---DLHALSQKELLEVFKKEGLFTLFKQRPFNIPALPTQSPRDVFINLADNRPFTPSVEKHLSLFSSKEDGYYIFVVGVQAIAKLFGLK..PHIVSTDRLSLPTQD.LISVAHLHTIAGPYPSGSPSTHIHHIARIRNDRDIVFTISFQEVLSIGHLFLKGFFLGQQVVALAGSALPPSQRKYLITAKGASFKDLLPQEIF-SSNDVSLISGDPLTGRLCNKEENPCLGMRDHTITILPNPKT-REMFSFLRLGWNKLTVTRTYLSGFF.KRKRVFMDMNTNLHGEKRPIIDSEIYEKVSAIAVPVAPLIKALETQNFEEACRLGLLEVSPEDFALPTFIDPSKTEMFAIVKEALIRYAKEN
NQRA_CHLPN/2-459 KITVNRGLDLSLQGSPKESG-FYNKIDPEFVSIDLRPFQPLSLKLKVEQGDAVCSGAPIAEYKHFPNTYITSHVSGVVTAIRRGNKRSLLDVIIKKTPGPTSTEYTY---DLQTLSRSDLSEIFKENGLFALIKQRPFDIPAIPTQTPRDVFINLADNRPFTPSPEKHLALFSSREEGFYVFVVGVRAIAKLFGLR..PHIVFRDRLTLPTQE.LKTIAHLHTVSGPFPSGSPSIHIHSVAPITNEKEVVFTLSFQDVLTIGHLFLKGRILHEQVTALAGTALKSSLRRYVITTKGASFSSLINLNDI-SD-NDTLISGDPLTGRLCKKEEEPFLGFRDHSISVLHNPTK-RELFSFLRIGFNKPTFTKTYLSGFF.KKKRTYTNPDTNLHGETRPIIDTDIYDKVMPMRIPVVPLIKAVITKNFDLANELGFLEVCGEDFALPTLIDPSKTEMLTIVKESLIEYAKES