EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05868 alignment
(3 sequences with 249 aa)


P87518_9REOV/1-247 MPLPLLLVFAACAKAQLVITPISNPEICVLHASDW--NVNSFGDNFTNIFETYNSVTLSFYQYDSTNYEVIDIISKRDYSLCHILAIDVVKPEMDFITFLQSNNECTKYAGQKIHYQKLSTNEEWFVYSKNLSLSPLSDSLIGLYCDTEINGTYFPLSENEKYDVTDLPEFTEMGYVFYSNDDFYICKRINDHKWVNYHLFYREYSASGTVSRAISWDNVWTGFKTFAQVVYKILDIFFNNRRNFEPRA
VS09_ROTGA/1-249 MASLLLLVLAAAVTAQLNIVPSTHPEVCVLYADDHQADANKFNGNFTQIFHSYNSITLSFMSYSSSSYDVIDIISKYDLSSCNILAIDVFNASMDFNVFLQSTNNCSKYNANKVHHVKLPRGEEWFSYSKNLKFCPLSDSLIGMYCDTQLSDTYFEISTGGTYEVTDIPEFTQMGYTFHSSEEFYLCHRISSEAWLNYHLFYRDYDVSGVISKQVNWGNVWSGFKTFAQVLYKILDLFFNSKRNVEPRA
VS09_ROTGI/2-246 TTMLLLLVVAALANGQLTILPHEESQICFLQPDNPGFD---FDGNFTNIFRDYASVKISSFTYKAQDADIVEILNVDRDRSCTILAIYIADSTLDFNTFLQSENECVKYAASKKHYIKLPRDREYFALAKNLSFCPLNDDLIGIYCDTQLETTYFSVARSSNYDVTDIPEFTELGYVFHSNDHFYICERKSEGNWIDYQLFYQNDAPLGTVSQRVNWGNVWSNVKTVAQMVYKILDIFFG-KRNIEPRA