EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05862 alignment
(3 sequences with 94 aa)


Q9ZIW8_HELPY/1-94 MAVVVKIVNGKIQEFENGSHKRTYGSNIVAADTDGHIVAAVTTKGKIEEYENGHCRRIYGSNAVNVQVSGGIVAVTTSKGKVEEYENGHCRRIY
Q8VTH2_HELPY/1-59 MAVAIKVVNGKIQEYENGNYKRTYGSNIVAADTDGHIVAAVTA-----------------------------------KSKVEEYKNGIHKRTY
Q9F9S3_HELPY/1-59 MAVVIKVVNGKIQEYENGIHKRTYGSN-----------------------------------AINVQVSGGVVAVTTSKGKVEEYRMVFIKEAT