EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05851 alignment
(4 sequences with 252 aa)


P89687_9RETR/2-252 SGEEDWQVSRSLYQVLLGGPRRAMLYIGSIIDEKEKARKKKDLQKRMARLENRFIYWLRRQEGIRWSFHTRDYHLGFVKELVAGSSSPGCLRLYCYISNPLWHKRYRPTL-QMNQEFPYVNCWITDKFMWDDIENQQIMKSPLPGPGWDIGMVGLVIKAYSCPEKKYDVTIPQVIRGEKDPQEFCADCWNLICVRNSPPCSLQRLALKACGKPTESWVGCCNHRFLSPYRSPTDLLIVREAVPYEVLYRMKS
Q66934_9RETR/1-251 MSDEDWQVSRRLFAVLQGGIHSAMLYISSL-PEMEQNKCKRSFKKRLSDKETGFIFRLRKAEGIRWSFHTRDYYIGYVREMVAGSSLPDSLRLYVYISNPLWHQSYRPGLTNFNTEWPFVNMWIKTGFMWDDIESQNICKGGEISHGWGPGMVGVVIKAFSCGERKIKITPAMIIRGEIDPQKWCGDCWNLMCLKYSPPNTLQRLAMLARGKEAKEWRGCCNQRFVSPFRTPCDLEVVQNKPKRNLLWTGEL
VIF_FIVSD/1-251 MSDEDWQVSRRLFAVLQGGVYNAMLYISRL-PQDEREKYKKDFKKRLLDTETGFIKRLRKAEGIKWSFHTRDYHVGYVREMVAGPTTPHSLRLYVYISNPLWHSQYRPGLVNFNKEWPFVNLWIKTGFMWDDIEKQNICIGGEVSPGWGPGMIGIAIKAFSCGERKIEATPVMIIRGEINPKKWCGDCWNLMCLRNSPPETLQRLAMLACGVQAKSWRGCCNQRFVSPYRTPADLEVIQSKPGWCMLWRGKL
Q84810_9RETR/31-272 LQDEYWHLNQ-LFVTYQIGIRTPSLWLTN-KDKLD----KFLLKKKLKHLEDKWVKQIRQADGIKWSLHTREWHTSLVKECVAGTG--NGLKLFVYIHSPLWR-EYRPNY-DWNPNWPYANCWISRKYMWDLDDSIKILSRNRPMEGWPPGWLGVVIKAFCCKECKYDWNPMEVIRQDIDPWDYCGDCWLFIVIRNTAPGSLQRLCMLQLGRPLLSWKCKSQCTFLDWRRTPLDALVIQDCLPWQWRVWMDL