EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05825 alignment
(7 sequences with 114 aa)


MSMB_RAT/1-113 MKARLGSLLVLATLVTASNAACSIQRLKRLPNEKSDECTDVDGGKHVLNTYWQ-KNCEWCFCEKTAITCCTKTLIPVSYDKKRCQRQFHSENCTYSVVERTNPGKTCPVNGWTI
MSMB_MOUSE/1-113 MEAWLGSLLFLATMVIASKAVCSIENREIFPNQMSDDCMDADGNKHFLNTPWK-KNCTWCSCDKTSITCCTNATRPLSYDKDNCDVQFHPENCTYSVVDRKNPGKTCRVDSWTM
MSMB_HUMAN/1-114 MNVLLGSVVIFATFVTLCNASCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII
MSPJ_SAGOE/1-114 MNVLLGGLVIFATFVTLCNASCYIILNDMIPGDSTNECTDLKGNKHPINSKWRTDNCDSCTCREKEISCCTLVSTPVGYDTHKCQKIFNKEDCRISVVEKNDPSKTCEVNAWIM
MSPA_SAGOE/1-112 -NVLLGGLVIFATFVTLCNGSCYLMPNKMVPGDSTKECTDLKGNKHPLNSRWKTENCDECDCLEKEISCCSLVAIPVGYDQDNCQKIFKQEDCKYIVVEKKDPNKTCEVTQWI-
MSPE_SAGOE/1-114 MNVLLGGLVIFATFVTLCNGSCYVIRHKIVPGETIKECTDLKGNKHPLDSRWRTEDCELCACRDIEISCCSLVSTPVGYDRHNCRKIFNKETCKISVVEKTDPNRPCGVSGWIS
MSMB_PIG/1-111 MKFLLGTLVVLATFVTLCNSQCYFIPNQSL---KPNECQDLKGVSHPLNSVWKTKDCEECTCGQNAISCCNTAAIPTGYDTNKCQKILNKKTCTYTVVEKKDPGKTCDVTGWVL