EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05732 alignment
(4 sequences with 199 aa)


Q52051_BUTFI/9-206 HVTTKKVKAIGTETYINVATGEAEEFQVTKIEERDFNFTKVWIRNFVATLDLVGNQKTRLVYWIIDNLN-HNNQLICTNRLMAEETGISLATVSVTMKALQDANFLKKQANGVYVINPDILFKGTQKARLNILNQFSELGAEPQELSDEQKIQNITKTIAQLSKQLEALQSKSSVVDTEIEGQYTLLPDGSIVQKAVNK
O50587_SELRU/6-169 VTTRKKVKVTGTETYINQSTGEIKEMQVIDIEERDFNFHKVWLEHIIHSMDLIGNQKTRLAFWLINNLN-RDNVLIMTQRKIAEKTGISLETVRQTMKALMESGFLIKINSGAYCVNPDAVFKGGKTDRLNVLIQYRKSEQENTKTSEPTSEKD----------------------------------EPSLFNNEQLK
Q06462_STAAU/1-154 MKERYGTVYKGKEEFINKDSGEVIQFDKLYRAQTGGNFVKSTWNCLLQMLGLM-NKRGEVMQYLFKDLNLSSNTVIKTVRELAKETNTSTKTVTETLKIMEKGNIIKRKT-GVIMINPALLMRGDDSKKRYLLLEFEQFDRENE-------------------------------------------LEHALNEYESFK
REMA_STAEP/1-157 MKERYGTVYKGSQRLIDEESGEVIEVDKLYRKQTSGNFVKAYIVQLISMLDMIGGKKLKIVNYILDNVHLSNNTMIATTREIAKATGTSLQTVITTLKILEEGNIIKRKT-GVLMLNPELLMRGDDQKQKYLLLEFGNFEQEANEKQ-----------------------------------------ENALYLIIILS