EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05715 alignment
(12 sequences with 62 aa)


PCLO_MOUSE/963-1023 PKPACPLCRTEL.NVGSQDPPNFNTCTECKNQVCNLCGFNPTPHLTEIQEWLCLNCQTQRAI
PCLO_RAT/1006-1066 PKPACPLCRTEL.NLGSQEPPNFNTCTECKNQVCNLCGFNPTPHLTEIQEWLCLNCQTQRAI
PCLO_CHICK/832-892 PKVSCPLCKTGL.NIGSKDPPNFNTCTECKKVVCNLCGFNPMPHIVEVQEWLCLNCQTQRAM
BSN_RAT/457-517 ERAACPLCQAEL.NVGSRGPANYNTCTACKLRVCTLCGFNPTPHLVEKTEWLCLNCQTKRLL
BSN_MOUSE/459-519 RAAACPLCQAEL.NVGSRGPANYNTCTACKLQVCNLCGFNPTPHLVEKTEWLCLNCQTKRLL
BSN_HUMAN/460-520 ERAICPLCQAEL.NVGSKSPANYNTCTTCRLQVCNLCGFNPTPHLVEKTEWLCLNCQTKRLL
PCLO_MOUSE/498-559 SKTICPLCNTTElLLHTPEKANFNTCTECQSTVCSLCGFNPNPHLTEIKEWLCLNCQMQRAL
PCLO_RAT/519-580 SKTICPLCNTTElLLHIPEKANFNTCTECQSTVCSLCGFNPNPHLTEIKEWLCLNCQMQRAL
PCLO_CHICK/364-425 KKTFCPLCTTTElLLHTPEKANYNTCTQCHTVVCSLCGFNPNPHITEIKEWLCLNCQMQRAL
BSN_RAT/162-222 SSTLCPICKTSD.LTSTSSQPNFNTCTQCHNKVCNQCGFNPNPHLTQVKEWLCLNCQMQRAL
BSN_MOUSE/162-222 SSTLCPICKTSD.LTSTPSQPNFNTCTQCHNKVCNQCGFNPNPHLTQVKEWLCLNCQMQRAL
BSN_HUMAN/165-225 SSTLCPICKTSD.LTSTPSQPNFNTCTQCHNKVCNQCGFNPNPHLTQVKEWLCLNCQMQRAL