EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05705 alignment
(10 sequences with 296 aa)


Q9TZH9_CAEEL/13-269 RDTIVALLGWA-----GAVDRNVEKYAGIYQ---KKGYTTVQFTALAAVKGWGTKDGRN------VDHLASTLDSVLINPSNR--LVFHVFSMNGFIALTSLDSQFPELK----AIEKCDGIFMDSCPAcFSFSIENMQKHALVMNHVYDQLIKNS--..--------NFVLGNFYKVYKKWETARFGYQMIMDTMSIKAG.LCTIEEANPFFYLLNHPHLPPILTSIFSDNDIVCSADEINLFNECAAK--KSDKKRQIMATRLKDTAH----VEHFRKYPKLYLEKMDEFLQKV
Q22750_CAEEL/59-309 SKTLVVLFGWA-----GCRDRYLSKYAQYYQ---DAGISTVRFTAPIAKIRSFSSYRPF----ALCFHRILNEILHDQNDITT--IYFHVFSMNGCSLLAAYWDQLQDLENGKEVLSKSRGLIFDSCPA.FTSPSQSAQAISFATLPPSHY--HGA--..----------LRGSYRAVLYTFFSFHRG-VLWLRSFLEK--.-DIYERHYAYFKMITFDNLPAKQLYIYGPADLVCSEESIEEYAQLMEQ-----RGVSISKLRLLDSLH----CQHLRSHPVTYTQECLDFVKSG
Q9TZH8_CAEEL/67-320 KKPVILMVGWA-----GANPKHIDKYIKVYN---DEGYRVVSLCPPCYHYSIPNSRVGFYMSP-LFRAIDAKPGDFRSFAKCP--IIVHSFSMNGVRGLISFWKWTEAEE-KPQLRERIKGIIFDSAPS.RPYGKQDATAMVISTPPIDAFER-----..---------WISEQTRISVLTWFLNLRAYLQIPLLTMVP--.-FLRSFVSIYYYLQTHIALPRDQLYLYSKADTMIKAKHVEKFIEKQKE-----KGNSVTAIDFVDSEH----VAHIRTHPKDYRTACLNFVRHV
Q9LHE8_ARATH/161-425 NRTVVVLLGWL-----GSKQKHLKKYADWYT---SKGYHVITFTLPMNEIMSYQVGGKAEKNIESLVNHLADWL--DEEQKKN--LVFHTFSNTGWLTYGAILEKFQKQD--SSLMGRVKGCIVDSAPV.AAADPTVWASGFSAAFLKKSS--VATKGsaSSSYESNGINISQPKPAATETALLLVLE-KFFAVILNLP--.-KVNRRLADVLDTLSTAQPSCPQLYIYSSADRVIPVEQVESFIVEQRK-----AGHEVRACNFISSPH----VDHFRSNPELYTAELNHFMNNF
Q8LG51_ARATH/121-389 KETTVVLLGWL-----GAKAKHLRRYVEWYN---SRGINAVTFTVDVRDLLRLDLGRRLERRIAEFGNELVNWVSEKEDDGREKCLVFHSFSNTGWLVYGALLESFIGRQ---DLVERIEGCIIDSGGA.DPLDTKIWAAGFTAAILKKRSSTITTEP..NSPIKEEDASTPQKKEPLGIENIMLSSLEKLFPIFLNHP--.-DVNTRLTKIIQKLYENHPPCPQLYLYSSGDKVVPSHSVELRIREQQK-----IGRKIHSFNFKSSPH----VDHYRNFPDLYSSQLQNFLQEC
Q8SXH2_DROME/74-317 HVPIVMLLGWA-----GCQDRYLMKYSKIYE---ERGLITVRYTAPVDSLFWKRSEMIP------IGEKIIKLIQDMNFDAHP--LIFHIFSNGGAYLYQHINLAVIKHK----SPLQVRGVIFDSAPG.ERRIISLYRAITAIYGREKRC-------..--------NCLAALVITITLSIMWFVEESISALKSLFVP--.-SSPVRPSPFCD-LKNEANRYPQLFLYSKGDIVIPYRDVEKFIRLRRD-----QGIQVSSVCFEDAEH----VKIYTKYPKQYVQCVCNFIRNC
Q8MLS7_DROME/71-302 GNPLVLMMAWL-----MAKQKHLKKYAQIYT---EMGFDVVVVHITPWQLLWPVKGSQV------VAAETIRFL-ENNKSYEP--IVMHGFSVG---AYQLG-EIMLQMS----RDMDRYGSILD----.-RFVCQVWDSAADIT--EIPVG------..----------VPKSIFPRNERMQSALRNYTLYHLKTFHN--.-QATIHYMRSSQMFHSTLLKAPALFFVSDNDPIGPPSSNQSVREDWER-----ANIKVTFKCWERSQH----AAHYIRHREEYLQTLFQHLETC
Q9C445_PENPX/34-287 EPTTIIIFGWG-----DGMPKHVSKYADGYHELFPCARIVVVLSRTFQASNQPLDARIEAMLP--VIDTVFPTPTGSGNEDER--VLMHAMSNTGGIFLAAAFTAYQQRH-GADKKLPHTLLVCDSTPGsLDFASQVGRWSRAMAVGTAKY-------..----------FPWPFAMTQGFWWLFLWANYAWELLRGTE--.-PSGVWATRVMNDHSVAPIEPNRLYLYSKEDEIIWWEDLEQAVAEVKR-----QGYTVDLEMFEGSPH----VGHMRLHPEQYWGKISNAWKET
Q9FFG7_ARATH/96-379 GGPNACMYKVLQILEGTCETGLNPDDCRLVRNC-ISGFIYDSCPVDFTSDLGARLAVHPTTLKMSSPPKPFVWAANGIASSLDY-VFLNRFESQRAEYWQTLYSTIIMRV-PYLILCSENDDLAPYQTI.HNFATRLQELGGNVKLVKWNDSPHCG--..--HYRYNQVDYKAAVSEFLSKAASVYSQKTRSLDREAMKGTcHDEITEPIQSLGQSTSGLNRSFNGTPLVTTDHFFVPSTVGYYVGRDGG--YVQDEHKQDLICLSNTQTNESVKPNGVLGQILFDVYIPKNVEDW
Q8S8H8_ARATH/104-385 GAPKACMYKVLQVIMDDCEAQIHPDDSQLVRTC-LSGHVYDSGPLDFTSDLNVKFALHPTIRRMSGPSRLVSWVAKGISSGLDG-LYLTRFESQRSEYWQALYSSVEIGA-PYLILCSENDELAPLQVI.SSFTHQLQELGGEVKVVKWKNSPHAG--..--HYAHNPIQYRAVISNFLEKAISVHLHKIRQLGERAHT--.HDEISELICDLQKVAVNSNQSLRRVATGPCDHFFLPSSAPYQSNSNNSDPSSSQEEQRERSSFRPLQP-TSINAHSVLGQFLFDSCVPKNIEGW