EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05702 alignment
(8 sequences with 118 aa)


Q9E207_9ALPH/1-87 M-AS------NCSLELFMLLLLSVFTSAHTT-------------------HKLPEHRN-----FWHASCSARGVYIDGSAIATLFFYASLLGVCVALTALAYNACFRLFTRSVLRSTW
Q9DH60_9ALPH/1-94 M-GSVGVHHISPSWSVYVIWIVCVHVVLAVD-------------------GERSIAGA----DFWDSTCSAVGVSIAFSSGFSVLFYLGLAAAISALLVGSYSACFRLFTADMFREEW
O89248_9ALPH/1-95 M-GLSDIHHVVCKVLICVIASLVESRATSID-------------------SGRPIAVAG---NFWESTCSAVGVSIAFSSGFSVLFYLGLVAVISALLAGSYHACFRLFTASMFDDGW
Q69317_9ALPH/1-95 M-GLMDIHNAVCSLVIGVAILIATSQATFVD-------------------WGSSITSMG---DFWESTCSAVGVSIAFSSGFSVLFYMGLVAVISALLAGSYHACFRLFTADMFKEEW
Q89806_9ALPH/1-91 MPRS------PLIVAVVAAALFAIVRGRDPL---------------------LDAMRREGAMDFWSAGCYARGVPLSEPPQALVVFYVALTAVMVAVALYAYGLCFRLMGASGPNKKE
Q9IF47_9ALPH/1-98 M-VSSARLSLTLVAALCALVTPALSSIVFSE-------------------GSLPLLREESRTSFWSAACAARGVPVDQPTAAAVTFYICLLAVLVVALGYATRTCARMLHTSPAGRRV
Q66598_9ALPH/1-99 M-LS-ARL-VALAILTCLLVVFGLTRGASGDLEAK---------------QRLDVAREEERRDFWHAACSGHGFPITTPSTAAILFYVSLLAVGVAVACQAYRAFLRIVTLEML-RHL
O56867_9ALPH/1-117 M-RLPWERSFMLLGAVVYLLHLALVFAQPGVTPGHGMEHGYYGLGAGNMLGAENSMYSANMEHFYHSACSSRGFSLVNGTAASVFFFISLAVALIGLLAVLYNGCFNSFKSSVISSRW