EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05694 alignment
(8 sequences with 487 aa)


Q8ZUL2_PYRAE/4-459 LKPDPTFYPTPRDAMRAPPEDIAYVAALYVGTGVNAPDFLAVVDVDPKSPTYGKVIYKLDLPYIGDELHHFGWNACSSAYCPNAKPFLERRYLIVPALRSSRIYIVDTKPDKRRPAVAKIVEPEVAVGRTGYTKYHTVHC-GPDAIYISALGGPDGREGPGGIFLLDHDTFEPIGRWEVYRGPQYFAYDFWWNLPSGVMITSEWTVPRCFEEGFSLECLKEGAYGNKLHVWDLAKRRHLYAIDLGQE.HRMVLEVRPLHDPTKLMGFVNVVLNTKDLSSSIWLWFYEDGK--WQAERVIDIEAQPFEGPLPPVLKDFKMVPPLVTDIDISLDDRFLYVSLWGLGELRQYDITNPHQPRLAGRVKIGGLYHREP-----------------HPSGAEATGAPQMISVSRDGRRVYITNSLYSSWNNQFY.P-GLR--GWMAKVNVNP-EGGLELEKEFFVDFGRA-----RAHQVRLWGGDASTDSFC
Q976Y0_SULTO/6-460 FKRDPTFYPSPKMAMKAPPEDLAYVACLYTGTGINRADFIAVVDVNPKSETYSKIVHKVELPYINDELHHFGWNACSSALCPNGKPNIERRFLIVPGLRSSRIYIIDTKPNPREPKIIKVIEPEEVKKVSGYSRLHTVHC-GPDAIYISALGNEEG-EGPGGILMLDHYSFEPLGKWEIDRGDQYLAYDFWWNLPNEVLVSSEWAVPNTIEDGLKLEHLKD-RYGNRIHFWDLRKRKRIHSLTLGEE.NRMALELRPLHDPTKLMGFINMVVSLKDLSSSIWLWFYEDGK--WNAEKVIEIPAEPLEGNLPEILKPFKAVPPLVTDIDISLDDKFLYLSLWGIGEVRQYDISNPFKPVLTGKVKLGGIFHRAD-----------------HPAGHKLTGAPQMLEISRDGRRVYVTNSLYSTWDNQFY.PEGLK--GWMVKLNANP-SGGLEIDKEFFVDFGEA-----RSHQVRLSGGDASSDSYC
Q8RZW7_ORYSA/13-482 GATGPGYATPLEAMEKGPREKLLYVTCVYNGTGINKPDYLGTVDVDPNSPTYSQVIHRLPVTHVGDELHHSGWNACSSCH---GDPSASRRFLILPSLLSGRVYVVDTLKDPRAPALHKVVEAEDIAEKTGLGFPHTSHCLASGEIMISCLGDKEGNAAGNGFLLLDSE-FNVKGRWEKPGHSPLFGYDYWYQPRHKTMISSSWGAPAAFRTGFDLQHVQDGLYGRHLHVYDWPGGELKQTLDLGST.GLLPLEVRFLHDPSKDTGYVGCALT----SNMVRFFKTADGS--WSHEVAISIKPLKVRNWILP------EMPGLITDFVISLDDRYLYLVNWLHGDIRQYNIEDPAKPVLAGQVWAGGLLQKGSEVVYVTEDDKEEQYSVPQVKGHRLRGGPQMIQLSLDGKRIYVTNSLFSRWDEQFYgQDLVKKGSHMLQIDVDTEKGGLSINPNFFVDFGAEPEGPSLAHEMRYPGGDCTSDIWI
Q9LK38_ARATH/13-480 CKSGPGYATPLLAM-SGPREKLIYVAAIYTGTGQAKPDYLATVDVEPSSSTYSSVIHRLPMPYLEDELHHSGWNSCSSCY---GDSSCERRYLILPSLLSGRIYVIDTKTNPREPSLHKFVDPAEVLEKTGLAYPHQPHCLASGDVLVSCLGDEDGNAEGSGFLLLDSE-FNIKGRWEKDGNSPLYGYDFWYQPRHKTMISTSWGAPAAFTKGFDLKDVSDGLYGKHLHVYSWPQGELKQILDLGDT.GLLPLEVRFLHEPDKATGFAGCALS----STLVRFFKNDDET--WSHEVAISVEPLKVENWILP------EMPGLITDFLISLDDRFLYCSNWLHGDIRQYNIEDPKTPVLTGQIHVGGLVQKGSLVLALGEEGKAFQFDVPKIKGQRLRGGPQMFQLSLDGKRLYVTNSLFSVWDRQFY.PELVEKGSHMLQIDVDTDKGGLSINPNFFVDFGTEPDGPSLAHEMRYPGGDCTSDIWV
Q93VA1_LOTJA/20-487 CKSGPGYASPIESM-SGPRESLIYVTAVYAGTGIEKPDYLATVDVDPSSPTYSKVIHRLPVPYVGDELHHTGWNSCSSCH---GDPSAERRFLIAPSLVSGRIYVIDTKTNPRSPSLHKVVDPADIIQKTGLAYPHTSHCLASGELMISCLGDKDGNAEGNGFLLLDSD-FNVKGRWEKPGHSPLFGYDFWYQPRHNTMISTSWGAPTAFTKGFDLQHVADGLYGRHLTCIQLARGELRQTLDLGNT.GLLPLEIRFLHDPAKDTGFVGSALS----SNMIRFFKTQDGS--WSHELAIPVKPLKVQNWILP------EMPGLITDFLISLDDRFLYFVNWLHGDIRQYNIEDLKNPVLTGQLWVGGLIQKGSPVAAIGEDGKTWQSDVPEIQGQKLRGGPQMIQLTLDGKRLYVTNSLFSAWDKQFY.PGLVEKGSHILQIDVDTEKGGLKINPNFFVDFGAEPDGPALAHEMRYPGGDCTSDIWI
O23265_ARATH/20-478 CKSGPGYATPLAAM-AGPREKLIYVTALYSGTGRDKPDYLATVDVDPSSPTFSSVIHRLKMPYIGDELHHTGWNSCSSCH---GDASADRRYLVLPGLISGRIYAIDTKTDPKAPSLYKVVEPKEIAEKTGLAFPHTSHCLASGDMLVSCLGDKEGNAKGNGFLLLDSD-FNVKSRWDKPGHGPLFGYDFWYQPRFKTMISTSWGAPKAFSKGFNLQHVADGLYGSHLHIYQWPEGEMKQITYWVF-.VVMWLQIRFLHDPSKDTGYVGSALS----SNMIRFFKNSDDT--WSHEA--------IENWILP------EMPGLITDFLISLDDRFFYFVNWLHGDIRQYNIEDPKNPVLTGQIWVGGLLQKGSPYKAVGEDGNTYQFDVPQIKGKSLRAGPQMIQLSLDGKRLYATNSLFSAWDRQFY.PEIMEKGSHIIQIDVDTDKGGLTLNPDFFVDFGDEPDGPALAHEMRYPGGDCTSDIWI
Q91X87_MOUSE/6-472 TKCGPGYSTPLEAM-KGPREEIVYLPCIYRNTGTEAPDYLATVDVDPKSPQYSQVIHRLPMPYLKDELHHSGWNTCSSCF---GDSTKSRNKLILPGLISSRIYVVDVGSEPRAPKLHKVIEASEIQAKCNVSSLHTSHCLASGEVMVSTLGDLQGNGKG-SFVLLDGETFEVKGTWEKPGDAAPMGYDFWYQPRHNVMVSTEWAAPNVFKDGFNPAHVEAGLYGSRIFVWDWQRHEIIQTLQMTD-.GLIPLEIRFLHDPSATQGFVGCALS----SNIQRFYKNAEGT--WSVEKVIQVPSKKVKGWMLP------EMPGLITDILLSLDDRFLYFSNWLHGDIRQYDISNPQKPRLAGQIFLGGSIVRGGSVQVLEDQELTCQPEPLVVKGKRIPGGPQMIQLSLDGKRLYATTSLYSAWDKQFY.PDLIREGSMMLQIDVDTVNGGLKLNPNFLVDFGKEPLGPALAHELRYPGGDCSSDIWI
Q9XXF9_CAEEL/9-471 CHGGPGYASPADAI-KGPREEVLFVTAP---NAADGPDAIFTVDVNPESDTFCQVISRVDVPHIGDEVHHTGWNACSSCH---DKPTEKRSHLIVPCLNSDRIYIINVENE-RKIYLEHTIEPSKLHS-LNLSFPHTSHCLADGNIMISTLGEANGTPSG-NFLLLDGKTFEPKGTWPADEKTVPFNYDFWYQPRRNVMISTEWGSPNHIKKGFNPAHVGEGLYGNSVHIFEWDSKKYLQTIDLPQPlGALPLEVRFLHEPTSEHAFVGCALG----SGIFRIHPVEENSTTHAATLVAFIPSKKVSGWALP------EMPALITDILISMDDRFLYVSCWLHGDIRQYDISDPLKVKLNSQVYIGGSVHTESNVKVLEGE---KPIEALYVKGRKIEGGPQMLQLSLDGKRLYVTTSLYKKWDDQFY.PEHVKSGATMVQVNIDPESGKMEINRDFLIDFGKIEGGPYLAHEMRYPGGDCTSDIWI