EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05690 alignment
(28 sequences with 263 aa)


THIG_STRCO/5-256 PFVLGGTTYASRLIMGTGGAPSLDVLERALVASGTELTTVAMRRVNASV---HGSVLSVLERLGIRVLPNTAGCFTAGEAVLTARLAREAL------GTDLVKLEVIADERTLLPDPVELLDAAETLVDDGFTVLPYTNDDPVLARKLEDAGCAAIMPLGSPIGSGLGIRNPHNFQLIVEHA-RVPVILDAGAGTASDVALAMELGCAGVMLASAVTRAQEPVLMAAAMRAGVEAGRLARRAGRIPRRH.FAEASSPAEGLAV
THIG_MYCTU/5-252 KLVIGDRSFASRLIMGTGGATNLAVLEQALIASGTELTTVAIRRVDAD---GGTGLLDLLNRLGITPLPNTAGSRSAAEAVLTAQLAREAL------NTNWVKLEVIADERTLWPDAVELVRAAEQLVDDGFVVLPYTTDDPVLARRLEDTGCAAVMPLGSPIGTGLGIANPHNIEMIVAGA-RVPVVLDAGIGTASDAALAMELGCDAVLLASAVTRAADPPAMAAAMAAAVTAGYLARCAGRIPKRF.WAQASSPAR----
THIG_CORGL/1-254 MLHIADKTFDSHLIMGTGGATSQALLEESLVASGTQLTTVAMRRHQATT-SSGESIFAMLRRLEIALLPNTAGCRTARDAVLTAQLAREAL------DTNWVKVEVIADEHTLLPDTVELLDACELLVHDGFTVLAYTSDDPITASRLEDCGVAAVMPLGSPIGTGLGILNPHNIELICSRA-SVPVILDAGVGTASDATLAMELGCDGVLLASAINRAQNPVAMAESMFHAVEAGRLAAQAGRIPQRQ.HAVASSSFEGLAS
THIG_PSEAE/10-265 PFVIAGRTYGSRLLVGTGKYKDLDETRRAIEASGAEIVTVAVRRTNIGQNPDEPNLLDVIPPDRYTILPNTAGCYDAVEAVRTCRLARELLD-----GHNLVKLEVLADQKTLFPNVVETLKAAEQLVKDGFDVMVYTSDDPIIARQLAEIGCIAVMPLAGLIGSGLGICNPYNLRIILEEA-KVPVLVDAGVGTASDAAIAMELGCEAVLMNTAIAHAKDPVMMAEAMKHAIVAGRLAYLAGRMPRKL.YASASSPLDGLID
THIG_XANCP/9-264 ALVIAGKPYRSRLLTGTGKFKDLDETRLATEAAAAQIVTVAIRRVNIGQDPNAPSLLDVLPPDRYTLLPNTAGCYTAEDAVRTCRLARELLD-----GHNLTKLEVLGDERTLYPDVVQTLKAAEQLVADGFEVMVYTSDDPILAKRLEEIGCVAVMPLAAPIGSGLGIQNKYNLLEIIENA-KVPIIVDAGVGTASDAAIAMELGCDGVLMNTAIAGARDPILMASAMRKAIEAGREAFLAGRIPRKR.YASASSPVDGVIG
THIG_CAUCR/17-269 TWTVAGRTFRSRLIVGTGKYKDYATNAAAARAAGAEIVTVAVRRVNLTD-PSQPLLVDYVKPTEFTYLPNTAGCFTGEDAVRTLRLAREAG------GWDLVKLEVLSDPKTLFPDMEETLRSLKLLVADGFQVMVYCSDDPVYARKLEEAGAVAIMPLGAPIGSGLGIQNRVNLRIIIENA-KVPVLVDAGVGTASDAAIGMELGCDAILMNTAIAEAKDPIRMAKAMKHAVIAGREAYLAGRMQKRL.YADPSSPLAGLI-
THIG_AQUAE/12-265 YLEIAGRKFKSRLIIGSGKFKDFQQTKEVLEASGAEIITVAVRRVNITD-PTKENLLDYIDPKKYLILPNTAGCYTAEEAIKTAMMAREAT------GINWVKLEVIGDQKTLLPDMEETYKAAKVLVKEGFVVLPYIFDDPVFAKKFEDIGCAAVMPLAAPIGSGLGLQNPYNLIFIKEAV-SVPVIVDAGIGSATDIPPVMELGVDGVLTNTALAEAKDPIKMAVAMKYATIAGRLAYLAGRMPKRT.YAVPSSPTKGVPF
THIG_BACHD/5-258 PLSIGGKTLTSRFFLGTGRYPNPFVQNEVIRVSEAEVLTFAIRRVNLQA-PGEDAILQHLEGKTFTYLPNTSGAKNAEEAIRIARLARASG------LSDWIKVEISVNERTLLPDPVETLRATETLANEGFTVLPYTSDDPVLCKRLEEAGAAAVMPGGAPIGTGLGILNPYNLGLIVEEA-NVPIIVDAGLGSAQDVVQAMELGADGVLMNTPVAKAKDPVKMALAMKHAIEAGRLSYLAGRIPKKR.YATASSGLETFIS
THIG_BACSU/3-256 MLTIGGKSFQSRLLLGTGKYPSFDIQKEAVAVSESDILTFAVRRMNIFE-ASQPNFLEQLDLSKYTLLPNTAGASTAEEAVRIARLAKASG------LCDMIKVEVIGCSRSLLPDPVETLKASEQLLEEGFIVLPYTSDDVVLARKLEELGVHAIMPGASPIGSGQGILNPLNLSFIIEQA-KVPVIVDAGIGSPKDAAYAMELGADGVLLNTAVSGADDPVKMARAMKLAVEAGRLSYEAGRIPLKQ.YGTASSPGEGLPV
THIG_DEIRA/6-259 LLTIGGQSFSSRLLLGTGKYRDFAVMQDALGASGTQIVTVAIRRVELKA-PGHDGLLDALDLDRFQLLPNTAGCRTAEEAVRVAKLARAAT------GVSWLKLEVIPDPKYLLPDPIGTLRAAEILVGEGFTVLPYVQPDGVLARALEAVGCATVMPLASPIGTGKGLRTPELIRTVIDGA-GVPIVVDAGLGVPSDAAQALELGADAVLVNTAIAEARDPVAMARAFALGVEAGRLGYLAGRMQQRD.SASPSSPAAGVVR
THIG_SYNY3/397-656 LLEIAGRKFHSRLMTGTGKYPSLTTMQESVASSGCQIVTVAVRRVQTNA-PGHEGLAEAIDWSTIWMLPNTAGCQTAEEAIRVARLGREMAKLLGQEDNNFIKLEVIPDTQYLLPDPIGTLEAAEQLVKEGFAVLPYINADPLLAKRLEEVGCATVMPLGSPIGSGQGIRNAANIGIIIENA-KVPVVVDAGIGTPSEAAQAMEMGADAVLINSAIAMAANPVAMAQAMGMATQAGRLAYLSGRMPIKA.KANASSPLTGLVG
THIG_CYACA/29-289 DFCIKNKKFQSRLILGTGRYRSLLEAKQSIEASGCDIVTVAIRRINADNIGFIKSLIKLINWQKYWLLPNTAGCQTAEEAIRVANLGQEIAKQLGQVDNNFVKLEVIPANKYLFPDPIGTLKAAEHLVKQGFVVLPYINSDPILAKQLEDIGCSAVMPLASAIGSGQGLKNIDNIRIIVEAS-KVPVIVDAGIGVPSEATQVMEIGADAVLINTAVAQCKVPVAMANAMRLAVAAGYEAHSAGRIPIKN.YARTSSPNFDRIG
THIG_PORPU/17-277 QFKISDKSFSSRLMLGTGKYKNLQDAINSINVSGANIVTVAIRRAQNTKNLGRTNLIDGLDWSKLWILPNTAGCESAEEAVRIASLGQEIVKKLGQFDNNFIKLEVIPDSRYLLPDPIGTLKAAEYLINKGFVVMPYIGADPVLAKQLENIGCATVMPLASPIGSGKGLRNLLNLKIIIENA-KIPVIIDAGIGTPSEAGKVMELGASAVLVNTAIARAKNSQTMARAMSLAVESGRLTYIAGRMPISE.KAEPSSPILGISK
THIG_ODOSI/7-261 TLKIGNKTFNSRLMLGSGKYRTIENAVNSIITSDCEILTVAVRRLPTKLTNDNTSFLKSLDWNKLWLLPNTAGSQTAEEAIRMAFLGHELACQLGQEDNFFVKLEVISDPKYLLPDPIGTLKAAEFLVKKGFTVLPYINADPMLALHLEDLGCATVMPLGSPIGSGQGLNNISNLQIIIENS-SIPVIIDAGIGTPSEAAKSMELGADGVLLNTAIAQAKTPEKMALAMKLAVEAGRLGYLAGRMEKNR.MQVQVLH------
THIG_VIBCH/1-253 MLKIADKTFQSRLFTGTGKFSNRHVMAEALAASGSELVTMALKRIDLAQR--DDDILAPLLSMQMNLLPNTSGAKNAADAVYAAELAREAL------ATNWLKLEIHPDPKYLMPDPIETLLAAEQLVKQGFIVLPYCHADPVLCKRLEEVGCAAVMPLGSPIGSNQGLASKTFLEIIIDQA-KVPVIVDAGIGSPSDAAQAMELGADAVLVNTAIAAAHDPIAMAKAFKLAVEAGRMAYESGLPSRVK.MATASSPLTGFLD
THIG_ECOLI/1-253 MLRIADKTFDSHLFTGTGKFASSQLMVEAIRASGSQLVTLAMKRVDLRQH--NDAILEPLIAAGVTLLPNTSGAKTAEEAIFAAHLAREAL------GTNWLKLEIHPDARWLLPDPIETLKAAETLVQQGFVVLPYCGADPVLCKRLEEVGCAAVMPLGAPIGSNQGLETRAMLEIIIQQA-TVPVVVDAGIGVPSHAAQALEMGADAVLVNTAIAVADDPVNMAKAFRLAVEAGLLARQSGPGSRSY.FAHATSPLTGFLE
THIG_CHLTE/3-256 SLRLGTYTFSSRLILGTGKFSSTSAMIKAVRASGTQLVTVALRRFNREQAE-DDLFGPLSEIEGLTLMPNTSGAATAKEAIKAAHIARELS------GSPFIKVEIHPNPHHLMPDPIETWEACKILAAEGFIVMPYIPADPVLAKRLEEVGCSSVMPLGSAIGSGQGLSTAEMVKIIIRES-SVPVIVDAGLRSPSEACAAMEMGCEAVLVNSAVAVARDPAAMALAFAKAVEAGFEARNAGLMPRSG.SAVATSPLTSFLG
THIG_CAMJE/9-257 KLKIGKYEFDSRFILGSGKY-SLELIKSAIEEAKAQIITLALRRANTGEIA---NILDYIP-KNITLLPNTSGARNADEALRIARLSRELG------CGELIKIEVISDSRYLLPDNYETIKACELLAKEGFTPLPYMHADLYAARAMRDAGAAAIMPLAAPIGSNKGLCAKEFIQILLNEI-DLPIIVDAGIGSPSQACEAMQMGVSAVMVNTAIAEAKDIALMARAFSLAVNAGRVAFLAGVASVS-.EAKASSPLTGFLR
THIG_FUSNN/4-254 SFKLGNKEFNSRFILGSGKY-SNELINSAINYAEAEIVTVAMRRAVSGV---QENILDYIP-KNITLLPNTSGARNAEEAVKIARLARECI------QGDFIKIEVIKDSKYLLPDNYETIKATEILAKEGFIVMPYMYPDLNVARALRDAGASCIMPLAAPIGSNRGLITKEFIQILIDEI-DLPIIVDAGIGKPSQACEAIEMGVTAIMANTAIATANDIPRMARAFKYAIQAGREAYLAKLGRVLEkGASASSPLTGFLN
THIG_CLOPE/3-254 KLIIGGIEIKNRLFVGSGKYPSNEIIKDVLEGSGSQVITLALRRVDLDNK--EEDILQNIP-KDVILLPNTSGATNAEEAIRIARIARAMG------CGNWIKIEVISDSKYLLPDNEETIKATKVLADEGFIVLPYMCPDIYAGRRLIEAGAAAVMPLGAPIGSNRGLKTKELIQIMIDEL-DIPIIVDAGIGKPSQAMEAMEMGAAACLVNTAIASSEDPINMARAFKVAVEGGRLAYEAKMGRESK.FGNASSPLTGFLD
THIG_CLOAB/3-255 ELEIGGVKLDSRLFVGTGKLASNEVIPKIMEKSNSKVITVALRRVDITSK--QDNILNFID-KDLILLPNTSGARNAEEAIRLARIAKAAG------CGNWIKIEVISDNKYLLPDNYETIKATEALVKEGFIVLPYVNPDLMDARRLVNVGAAAVMPLGAPIGSNRGLRTKEMLKILIEEINEVPVVVDAGIGKPSDAAMAMEMGADAVLVNTAIATADNPVLMAEAFSLAVKAGRMAYVAKIGEEKE.YASASSPLTGFLR
THIG_NEIMA/1-256 MLTLYSETFPSRLLLGTAAYPTPEILKQSVRTARPAMITVSLRRAGCGGEAHGQGFWSLLQETGVPVLPNTAGCQSVQEAVTTAQMAREVF------ETDWIKLELIGDDDTLQPDVFQLVEAAEILIKDGFKVLPYCTEDLIACRRLLDAGCQALMPWAAPIGTGLGAVHAYALNVLRERLPDTPLIIDAGLGLPSQAAQVMEWGFDGVLLNTAVSRSGDPVNMARAFALAVESGRLAFEAGPVEARD.KAQASTPTVGQPF
THIG_RALSO/12-267 PLRLYDEVFGSRLLLGTARYPSPQSLEDAVRACGPAMLTVALRRQSAGTPEGGAGFWKMLRALGVPVLPNTAGCYSADEAYTLAQMSREVF------ETDWIKLEVIGDDYTLQPDTLALPAAAERLIRDGFKVLPYCTEDLVLCRRLLDVGCRALMPWAAPIGTGRGPTNPYGLRLLRERLPDVPLIVDAGLGVPSHATQVMEWGYDGVLLNTAVAQAGDPVAMARAFAMATQAGRLARLSGPMPERD.VAQASTPVVGLPF
THIG_ERWAM/1-250 --MFYDFVPQSRFLLGTAGYPSPQILQQAIEASGSEIITVSLRREGSQ----GGAFRALLTQLNKRVLPNTAGCHTVKEAVTTAYMARELF------NTRWIKLEVIGHADTLQPDPFALVEAARILCADGFQVFPYTTEDLILGEKLLEAGCKLLMPWGAPIGSGQGLRNIEGLRSMRSWFKDIPLIIDAGIGAPSQAAQAMEMGFDGILLNTAVARAQDPLGMAQAFASAIRAGYDARSAGLIERRD.MATASTPIFGMAQ
THIG_AGRT5/1-255 MLTLYGREVSSRLLLGTARYPSPAVLADAVRASNTDILTISLRREMAGAKKG-GQFFELIRELDRHILPNTAGCHTAKEAVLTAKMAREVF------RTDWIKLEVIGHHDTLQPDVFALVEAAKILCDEGFEVFPYTTDDLVVAEKLLEAGCRVLMPWCAPIGSAMGPLNLTALKSMRARFPEVPLIVDAGIGRPSHAVTVMELGYDAVLLNTAVAGAGDPVGMAEAFARAIEAGHQAYLSGPLEPRD.MAVPSTPVIGTAV
THIG_RHIET/1-255 MLKLYDVEVGSRLLLGTARYPSPAVLAEAVRRAKTEIVTVSLRREAAGGKAG-GAFFELIRELGVRVLPNTAGCHSVQEAVLTAKLARDVF------RTDWIKLEVIGHHDTLQPDVFGLVEAARILSGEGFQVFPYTTDDLVVAEKLLDAGCRVLMPWCAPIGSAMGPVNPMALRAFRAHFPDVPLIVDAGVGRPSHAAAVMEYGYDAVLLNTAVAGAGDPAAMAEAFALAIDAGRIAHSAVPLEPRD.MAVPSTPVIGKAV
Q8KJ35_RHILO/1-255 MFELFGTSLPSRLLLGTAQYPSPAILADAVKASGTSVVTVSLRREMAGGRAG-EKFWSLIRALGTRILPNTAGCHSVKEAVTTAKMAREVF------GTSWIKLEVIGNQDTLQPDVFGLVEAARILCEDGFTVFPYTTDDLVVAERLLEAGCKVLMPWCAPIGSALGPVNIMALRSMRGHFPDVPLIVDAGLGRPSHAATVMELGFDAVLLNTAVARAADPVGMARAFGKAVEAGREAYSSGMLEPRD.VAVPSTPTIGRAV
THIG_BRUME/1-255 MLEFYGKRFESRLLLGTAQYPSPSILADAVRASLSRIVTVSLRRESGEARAG-QDFWALIKALGVAVLPNTAGCHTPREAITTAHMAREVF------GTNWIKLEVIGDTDTLQPDPFGLVEAARILCDEGFEVFPYMNDDLIVAERLIEAGCKVLMPWGAPIGSGRGFNNPYALKTMRAHFPDIPLVVDAGIGVPSHAAAAMELGFDAVLINTAVAKAGDPAAMARAFALAVEAGRLAYEADPIEARD.MASPSTPLLGKAF