EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05677 alignment
(5 sequences with 372 aa)


Q9Z6X9_CHLPN/13-370 DTILETDPKPSLIMFSSKKTEIASERRKAHPTLFKVLGTIWNIVKFIISIILFLPLALLWVLKKTCQFFILPSSI--ISQ-SMS---KTAVAIRRMTFLSHIKQLLSLKEISAADRVVIQYDDLVVDSLAIKIPHALPHRWILYSQGNSGLMEN--LFDRGDS---SLHQLAKATGSNLLVFNYPGIMSSKGEAKRENLVKSYQACVRYLRDEETGPKANQIIAFGYSLGTSVQAAALDREVTDGSDGTSWIVVKDRGPRSLADVANQICKPIASAIIKLVGWNIDSVKPSERLRCPEIFIYNSNH-DQELISD-GLFERENCVATPFLELPEV-KTSGTKIPIPERDLLHLNPLSPNVVDRLAAVISNYLD
P94660_CHLCV/12-372 NSLITMNPQPEILIFSSEAARQAHRRRTLYPVIYKILDVICEIIKCIFRIILFIPFGLLWVLGKICQNCLLPAAGGLFTE-QLCFA----KKILQESFRCYVDDWLESGYASSVKRIPIQCDDLLIDAISIQFPDAEKDRWMLVSLGNSECFETRAMVYSRND---WILNVAKQARANVVVFNYPGVMHSKGPITRESLGKAYQACVHYLRDHPDGPKAKQIIAYGYSLGTLVQALGLSKEVVDGSDGVDWFVIKDRGPRSVAAIASQWLGKVAGWTATQLGWEINSAKYSESLVCPELFIHGEDY-QAQLIGD-GMFNRDNCFAAPFLDP-NAPKFPGKKIPVGEFLLQHKGELDETTIQNVVKHIIDHYS
Q9JS10_CHLPN/11-372 AAILDMHPKPSIAMFSSEQARTSWEKRQAHPYLYRLLEIIWGVVKFLLGLIFFIPLGLFWVLQKICQNFILLGAGGWIFR-PICRD----SNLLRQAYAARLFSASFQDHVSSVRRVCLQYDEVFIDGLELRLPNAKPDRWMLISNGNSDCLEYRTVLQGEKD---WIFRIAEESQSNILIFNYPGVMKSQGNITRNNVVKSYQACVRYLRDEPAGPQARQIVAYGYSLGASVQAEALSKEIADGSDSVRWFVVKDRGARSTGAVAKQFIGSLGVWLANLTHWNINSEKRSKDLHCPELFIYGKDS-QGNLIGD-GLFKKETCFAAPFLDPKNLEECSGKKIPVAQTGLRHDHILSDDVIKEVAGHIRRHFD
Q9K1U7_CHLPN/1-363 MSGIFSNPHP-VSYFSSTHAKQLSDFSKKHPILTKIVTIIVKIFKLLIGLII-PPLGIYWLCQLVCSLALFPRSSMLYSVLKTCFKKYRLEQEIQDYFVKNLDPSFKDPAVSESKRITIQQDHLTIDTLAIHFSTARPKRWLLISLGSGDFLED--MIGLKDSLFLSWKELAKLLGANILIYNYPGVKSSTGKLNLENLATAHNLCAKYLQDKIQGPGANEIITYGYSLGGVVQSAALQKNPFTNSE-TSWVAVKDRAPHSLPAAANSFFGPIGKLIAVLARWKMDAEKNSRELPCPEILVYSADRFRPSEVGDDTALLPEFTLAHAIKRTPFA----RSKKFIGEVNLLHSSPLKHPTIQKLAEAILESLS
Q9JRV1_CHLPN/12-369 EDILHSHPSPQATYFSSTRAQKLHEFKDRHPVLTRIASVIIKIFKVLIGLII-LPLGIYWLCQTLCTNSILPSKNLLKIF-----KKQPNTKTLKTNYLRALQDYSSKNRVASMRRVPILQDNVLIDTLEICLSQAPTNRWMLISLGSDCSLEEIAC----KEIFDSWQRFAKLIGANILVYNYPGVMSSTGSSSLKDLASAHNICTRYLKDKEQGPGAKEIITYGYSLGGLIQAEALRDQKIVANDDTTWIAVKDRCPLFISPEGFHSCRRIGKLVARLFGWGTKAVERSQDLPCLEIFLYPTDSLRRSTVRQNKLLAPELTLAHAIKNSPYVQ----NKEFIEVRLSSDIDPIDSKTRVALATPILKKLS