EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05659 alignment
(6 sequences with 158 aa)


Q9C5Z5_ARATH/2-148 PLTEI---------IAGAALGLALQILHEAIQRAKDRSLTTSCILDRLDSTILRITPLMAKVEKLNKESDES-LRKVFEDLKHLLEKAVVLVEAYAELK-RRNLLEKYRYKRRIKELEGSLKWMVDVDVKVNQWADIKDLMAKMSEMNTKLEKIMGQP
Q9SCS7_ARATH/2-148 PVSEI---------MAGAALGLALQVLHDAIKKAKDRSLTTRCILDRLDATIFRITPLVTQVDKLSEEVEDS-PRKVIEDLKHLLEKAVSLVEAYAELR-RRNLLKKFRYKRRIKELEASLRWMVDVDVQVNQWVDIKELMAKMSEMNTKLDEITRQP
Q9SCS9_ARATH/2-148 PLVEL---------LTSAALGLSLQLLHDAIIRAKERSLITRCILDRLDATLHKITPFVIKIDTLTEEVDEP-FRKVIEELKRLLEKAIRLVDAYAELK-LRNLLRKYRYKRRIKELDSSLRWMIDVDVQVNQWLDIKKLMGKMSEMNTKLDDITRQP
Q9C5Z6_ARATH/1-148 MIAEV---------AAGGALGLALSVLHEAVKRAKDRSVTTRFILHRLEATIDSITPLVVQIDKFSEEMEDSTSRKVNKRLKLLLENAVSLVEENAELR-RRNVRKKFRYMRDIKEFEAKLRWVVDVDVQVNQLADIKELKAKMSEISTKLDKIMPQP
Q9C5Z7_ARATH/2-143 PIGEL---------AIGAVLGVGAQAIYDRFRKARDISF-----VHRLCATILSIEPFLVQIDKRSKVEGSP-LREVNERLTCFLELAYVFVEAYPKLR-RRQVLRKYRYIKAIETIELALRSIIVVDFQVDQWDDIKEIKAKISEMDTKLAEVISAC
Q9SCS6_ARATH/2-152 PIAELAVIKTVGGPLIAAALGVGAQVIYDGFRKGKDTS-----IINRLGRTMESISPVRDRIGKLSNVEGK-PFREVHESLTRLLEDAKSIIEKYWKLRWSRHVCRKYRYIKKLESIELELV-RVAREIQVHQWTDIKEMKAIQVHQWTDIKEMKAIQ