EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05629 alignment
(3 sequences with 156 aa)


Q87011_9VIRU/1-153 MADWFHSALKTCTHVCDFSDIKASS---QQDFFCCDSMRGKLSEPRKVLLVSCFVSFTGSFYGSNRNVRGQVQLGMQQDDGVVRPIGYIPIGGYLYHDDYGYYQGEKTFNLDIESDYLKPDEDFWKRFTINIVNDKGLDDRCDVKCYVVHTMRIKV
O91251_9VIRU/1-153 MADWFSSPLKTCTHVCDFPSLAGDP---QQEIMCCDSMKNKLQDSRKVLLVSCSVSFNGSFYGGNRNVRGQLQISMVEDDGVCRPIGYVPIGGYLYHNDYGYYEGTRTFNLDLESQYLKKDEDYNRKFLVSILNENGLDSQCDLKVFIVHSIRIKV
Q65388_9VIRU/1-154 M-DWAESQFKTCTHGCDWKKISSDSADNRQYVPCVDSGAGR-KSPRKVLLRSIEAVFNGSFSGNNRNVRGFLYVSIRDDDGEMRPVLIVPFGGYGYHNDFYYFEGKGKVECDISSDYVAPGIDWSRDMEVSISNSNNCNELCDLKCYVVCSLRIKE