EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05627 alignment
(7 sequences with 89 aa)


Q9SEY4_ARATH/1-67 MASNEAGRALPKFGEWDVNDPATADGFTVIFSKAGEDKKTGRSS-----TKTNSQRKQDGDKP-----------------AVKKWLCFT
O22632_MAIZE/1-73 MA-EESGRPLPKFGEWDVNDPASADGFTVIFNKARDEKKGGNG--------------QDTDSPSKDPRTERVESYAAKP-STKKWFCCV
O22634_ORYSA/1-75 MA-AEKGSPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGGNS-------------QGQDLAAKSEQPSGQGLYPAKPNSSKKWFCCM
Q8LGF0_ARATH/6-73 QQRQQQDRPLPKFGEWDVNDPASAEGFTVIFAKARDDKKTNASG-------RAASQRRDNNKSQDE--------------PTKKRFCCF
O22633_ARATH/1-72 MS--DKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGGKP-------------GSPGKSSEG-HVKSGGGDPSKP-QPKKWLCCM
Q9FMJ6_ARATH/1-80 MA-ENKGKPLPKFGEWDVNNPASAEGFTVIFSKASDEKKTKKASGAGPNSLVSPQRNQNSDQNNNH--------SSQNPKAKNKWFCFR
Q8LCF4_ARATH/1-89 MATGNRARPLPKFGEWDATNPGSAEGFTVIFNKARDDKKTMKTAVAGPESIVSPPRNEEPPKNNNNHHHNHHTRHSQTPRSKKKWLCFR