EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05617 alignment
(4 sequences with 141 aa)


Q9LKB8_ARATH/27-149 VHEDVVISP------------TPFEKAISPAMEYEMKL-PHYSQKQYDFLEACVEKP--SSICGGEIFQNVLDETNLVTDKCCRNILKIGKDCHLGLMKILFSSYEYKNIAS--IPRSKQTWNDCLRRVGSKIGVPVSFE-
Q8LFP2_ARATH/34-172 MPEDVTISPSSDFDYVEAPYEAPFEEADSPAMEYDMELAHHYSDKQFKFLEACSEKP--SSKCGNEVFKNMLNETMPITEECCRDILKMGKDCHLGLVKLIFATYEYKNIASKGIPKSKQTWNECVRRVGSKIGAPVSFEQ
Q9C924_ARATH/21-149 IGQEEEISPISP---------ESLAYEPAAAYEYDHELLSHMTTRRIKFLQDCSDKM--SSKCNVEMTEGLIDDK-PVSEDCCVNFLKIGRECHEGLMTFVFATYELKDVASAILPRSKRMWNKCVETTAAKIGAPLAFET
Q8LG63_ARATH/17-143 NDKPLLISDDEF---------DAMMARSPTSDNYNENVGSKYSKKQINYLMNCSKKMAVPDKCIEEVMAEIIQNK-SASRYCCLGIVKAGKECHMEYMKLFFQMYELRRFTSKRFSKTNEIWNRC----STEIGVVSPYSG