EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05613 alignment
(2 sequences with 110 aa)


Q69038_9BETA/24-133 MDVWKRQRLQECRELCPLPVLMSLSNMFSKIEIVYVKYLFKMDFSTMYRYILPALTLSMTVTKSLVIEMLFILKRWEDIDQFFRLNIRKVNDCFIVAQFNHIPIKRWVLI
O56274_9BETA/1-110 METWRRQRLQEFRELCPLQILMTLSNIISKVETIYIKYLFQMDFNTTYRFIFSGLTLTTTVTKSVVIEALFIIKRWQEIKQIFNLDVHKTEDCYIVAQFTHIPVKRKITA