EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05582 alignment
(7 sequences with 302 aa)


Q9KGK3_BACHD/3-285 PKVGDIVARKSYQCDLLFRIVALH-.---NDFVELIGEDMRLAADAPYHDLVLIQESERKRR--KKEFLQAEEQCYKLFRQDYN--------LMKQRDEYEASSGYTNDAAF----FEMRGRVLHMDGDPLYLRKCTEVYDRLGVPVYGVHVSEKEMPEQIASLIEMVQPDIIVVTGHDAYLKNRGTEKDLKAYRHTKFFAECVRIARRYVPQRDELVIFAGACQSHFETLIKAGANFASSPNRVNIHALDPVYIASRVSITSFMERVSLSEVLRNTITGEKGLGGIETKGVMRKGMPLKAM
Q8EU40_OCEIH/3-285 IANGELVTRKSYDHDLLFRVIEIK-.---KDIAVLHGEDMRLAADAPLNDLSKVDQREKKRR--KEQEKEKQETSYRLFRQDYQ--------LMKEKRNYEATEGYSNAASY----FQLPAKVLHMDGDANYLRKCIQLYQRIGLQVHGVHLTEVQMPEEINDLLERIQPDILVITGHDAYSKNKGLKNDLRAYRHSKYFVETVREARRVVPNLDQLIIFAGACQSHFESIIRAGANFASSPSRVNIHALDPVYIVAKIAYTPFMESVSVWEALRNTLTGERGLGGIETKGLLRTGMPFVED
YABG_BACSU/3-290 FQIGDMVARKSYQMDVLFRIIGIEQtSKGNSIAILHGDEVRLIADSDFSDLVAVKKDEQMMR--KKKDESRMNESLELLRQDYK--------LLREKQEYYATSQYQHQEHY----FHMPGKVLHLDGDEAYLKKCLNVYKKIGVPVYGIHCHEKKMSASIEVLLDKYRPDILVITGHDAYSKQKGGIDDLNAYRHSKHFVETVQTARKKIPHLDQLVIFAGACQSHFESLIRAGANFASSPSRVNIHALDPVYIVAKISFTPFMERINVWEVLRNTLTREKGLGGIETRGVLRIGMPYKSN
Q97F48_CLOAB/1-299 MVIGDFVVRKSYGEDITFKIIDIIN.DKGVNYCVLKGVNLRIIADSPEDDLRLVQASNEGKV--DSVFNETINKSIRDIITERSNSIKIGKNILQKTYKKKKMRTSNSSEGINNMTFARPGKVLHIDGDSEYLEVCLKVYKQLSIDAVGKVILEKEQPEKVVDIVKVVKPDIVVVTGHDGMVKNTRNYMDINNYRNSSYFIKSVSNLRDYEPSYDDLVIFAGACQSCYEGILDAGANYASSPGRVLIHCLDPVFVCEKVAYTNVGDIVNIKEVVKGTVTGVKGIGGLQTRGKCREGYPKSSY
Q899A6_CLOTE/6-299 MNIGDIVARKSYGKDITFKIIDIQK.SKKGKLYKLKGVNLRIIADSLGNDLELVKEENTKYE---KVFDERINTSIKNILMNRGEEISTSKY-TRSSDKEIRVTRGKKNNGL---AFGRPGKILHVDGDAEYLDVCMKVYKQLELDVVGAIIAEKEQPEKVLQMVKEVKPDIVIITGHDAILKNTTNYMDLNNYRNSKYFIRTVNELRNYEPGYDNLVIFAGACQSYYEAILDAGANFASAPNRVLIHCLDPVFLCEKIAYSNIGKVVSIQEALENTITGANGIGGLQTRGKYREGFPKSLY
Q8XIA4_CLOPE/1-293 MKVGDLVVRKSYSKDITFKIIDIKE.NEEGITYILKGLHIRIIADSKREDLEKVEDDFAGDK--DKSFDSKMNDIIKKVILSRE---QKNNQLMTRGSEEDNLKRTEKEKGL---VFGRPGRILHIDGDPSYMETCLKAYKQLNLNAVGIAVSEREQPLKILSLVKEYNPDIVVLTGHDGVLKDSKGMLDLNNYRNSKYFIESVKILRNYNSSYDELVIFAGACQSCYESILEAGANFASSPNRVLIHCLDPVLVCERVAYTRIDEIVSIKDVIENTITGIKGVGGLQTRGKYREGYPKSLY
Q8R762_THETN/3-284 FRINDIVMRKSYGSDILFRVINVID.NKGVRYYLLHGLNMRIIADAPEDDL--IEASRAKIVEYDRPYREKAEYLLKKIAQSKS------------LQRKKGMARGVRQEPY-----GRPGKVLHIDGDEEYLNICMEAYRKVGMEVVGVVLKEEEQPEKVYDLLERYRPDILVITGHDSIKSSARDYGDLESYRNSKYFVEAVKNARKYEPSLDNLVIFAGACQSNYEALIKAGANYASSPERVLIHCLDPVLVSEKVAFSHINELVKIEDLIEHTITGAAGIGGLQTMGKFRYGVPKGKY