EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05569 alignment
(12 sequences with 97 aa)


Q97DN5_CLOAB/180-276 PCITGLIKPCILIPDYIAYKLTKEEIKYVIIHELSHFKHKDIIINWISIVLNVIHWFNPILYFFFRKFKQDSEIACDAKALSYIKSRERKEYGKTII
Q8RAW0_THETN/183-278 PAIFGIFKPYILISPEILK-LNEEEISYIFIHELAHLKRKDLLVNYLLLVLQILHWFNPFIWYFFKKIRQDMEVAADWKVLDILENNERKKYGRTLI
Q53709_STAAU/173-269 PMVFGLVKSQIVLPTVVVETMNDKEIEYIILHELSHVKSHDLIFNQLYVVFKMIFWFNPALYISKTMMDNDCEKVCDRNVLKILNRHEHIRYGESIL
Q8YAA1_LISMO/171-264 PIFLGLKKNVIVIPDETF---SNVELHYIFKHELVHCKRKDMYYVWMVQFFTCIYWFNPLMYLMNKRIQMDRELACDEAVLATLSKSKYIGYGDTLL
Q9K4N2_STAHA/170-266 PITFWYGKYIILIPSSYFKSVIDKRLKYIILHEYAHAKNRDTLHLIIFNIFSIIMSYNPLVHIVKRKIIHDNEVEADRFVLNNINKNEFKTYAESIM
Q8RPJ4_DESHA/160-252 PFVMGVLRPRIYLPASLS----GAEKEYILLHEQTHIRRFDHVVKILSFFVLCIHWFNPLVWAAFFLSGRDMEMSCDEAVIRKLGHEVKKDYSSSLL
Q8PED5_XANCP/181-276 PQLIGPWQPVLLLPAARLPHMADDDLDMALTHELIHLRRGDLWWGLLPALAQHLFFFHPLVHLAACEYGIAREAACDAAVVAGHRH-CRHEYGRLLL
Q9A4S6_CAUCR/151-246 PAVMGALWPRIVLPADFTQRFDARERDLIVLHERTHIQRGDPIANLFIAGAGVLCWCNPMIALAQHFIRIDQELACDATVVALRSD-IRTDYARALM
Q9A2P8_CAUCR/140-235 PMVLASPWPRIVAPADFDTRFQGEARDLVLAHERVHLARGDAQINALVVALQCLCWFNPLVHLGAHRLRLDQEMACDEAVLARRPE-ARRLYAETLL
Q9A7T1_CAUCR/152-247 PAVIGAVAPCVVLPADFDRQYTPEEQALILAHERNHLAVGDAQINAVVTGLQCLFWFNPFVHLGAATLRIDQEIACDAAVLARHPK-TRRAYGEAML
Q8PH97_XANAC/133-228 PVSVGLWRPRIVLPMDFDTRYSAAERTLILAHERLHLRRGDLYANLLAALLLCIGWCNPLMHLAWRAFRLDQELACDAEVLTRYPG-KRRSYATAML
Q8P5X8_XANCP/136-231 PASLGVWRPRIVVPADFATRYSGVERQLIVAHERLHLRRGDLQANLFAAVLLCLGWCNPLVHLAWRAFRLDQELACDAGVLARHPR-LRRRYADAML