EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05543 alignment
(5 sequences with 176 aa)


Q9EYW7_STAAU/219-393 eDQVQYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCATFPNQMIEYGKSQGRDIHYQEGVPSYEQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKIND-QEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGY
Q8KLJ1_STAWA/222-396 dNQVQYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDKYNAHDIMRTLYPNVSEEELPQFSTNPHQMIKYGNSQGRDIQHQSGMPSYNQIDQLTKDNKGAMILAHSVENNPNDPHLGHAMAVVGNAKINN-EDKLIFWNPWDTDLSIQDADSNLLHLSFNRDYTWDDTMIGY
Q9EWC9_STAEP/1-174 .MYAEYVNQLKNFRIRETQGYNSWCAGYTMSALLNATYNTNRYNAESVMRYLHPNLRGHDFQFTGLTSNEMLRFGRSQGRNTQYLNRMTSYNEVDQLTTNNQGIAVLGKRVESS-DGIHAGHAMAVAGNAKVNNGQKVILIWNPWDNGLMTQDAHSNIIPVSNGDHYEWYASIYGY
Q8RJP3_STAAU/225-399 gVRAQYVNQLKNFKIRETQGNNGWCAGYTMSALLNATYNTDRYNAEAVMRYLHPNLQGDDFQFTGLTPQEMMKYGKSQGRDTQYLNRMPSYNEVDKLTTNNKDIAILGSRVEST-DGIHAGHAMAVVGNAELEGGQEVIMIWNPWDRGFMTQDAESNIIPVSNGDHYQWNSSIYGY
STPA_STAAU/1-174 .YNEQYVNKLENFKIRETQGNNGWCAGYTMSALLNATYNTNKYHAEAVMRFLHPNLQGQQFQFTGLTPREMIYFGQTQGRSPQLLNRMTTYNEVDNLTKNNKGIAILGSRVESR-NGMHAGHAMAVVGNAKLNNGQEVIIIWNPWDNGFMTQDAKNNVIPVSNGDHYQWYSSIYGY