EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05524 alignment
(46 sequences with 128 aa)


Q9HXN5_PSEAE/283-404 LAGVCASPGLASGPLARLGAISLPADDGR.---HRPEEQHLALDQALQRVRDDVQGSLQQARLGGDENEAAIFSAHLALLEDPGLLDAADMLIDQGV-GAAHAWHRAIQAQCEILQAL.GNLLLAERA
Q9AAZ4_CAUCR/290-407 LKGVPAAPGLAIGKAVRLSTAEIVVREAG.---EGVAHEEAALAVALETVRARI----GKAAETGDKARKAILAAHQAFLDDPELYAGAHRLIAEGK-SAGFAWRRAVGGYVQALQAL.GDRRMAERV
Q8XQE5_RALSO/296-416 LRGVGASPGVAVGQIVRWSGIAPEFDETG.---GPFEQEHARLHAALQIAASQIKSLVTADTL-PDTPQAQIMDAHLAFLEDPMLIEAAEAGLRSGA-SAAGAWHLACQSVEQHLRLH.ANPQVRERA
PTF1_RHOCA/274-395 LVGISSSPGYALAPVFRFARDEVVFDTDA.---ADAAFETDRLDTALQTAWHELEELHDEVWKTSGPARAAIFRAHQEFLHDPEMVAEAKALIGQGR-SAGFAWHRVFSDRADMLGAM.KDAVLSGRA
Q98C54_RHILO/6-122 IEGVPASAGYAEGPLFDLDRPPAVYAGKA.----TLAEEKTSLQAAIGTAVSRLSAMAEAA----DSDAAGILEFHIAMLEDDALRGPAFASITSGQ-TADVAWREALDAEIAGYEAS.DQDYFRARA
Q9HY55_PSEAE/403-521 LQAIAASPGIASGPAHVQVAQRFEFQPRG.---ESPAHERERLLRAKRAVDEEIVGLVERSTV---KAIREIFVTHREMLDDPELAEQVQLRLNRGE-SAEAAWSRVVEDSAAQQEAL.HDALLAERA
Q8VP40_ECOLI/10-125 ISGLSVQNGIAIGPVKWFTCERPEITQRT.--VDSPQEELSRIESAIDIVVCEL-------ADKAAGPEGDIFAAHKMMLEDPEINRQLQQRLAKGK-QAEFAWLEVMQALAEQYCQA.ETLYLRERE
PT1_STRCO/5-124 LRGVGVSHGVAIGEVRHMGTAVLEPPAKQ.IPAEDAEREQGRARKAVEAVAADLMARGNLA----GGEAQAVLEAQAMMAQDPELLADVERRITVGS-TAERAVYDAFAAYRALLAG-.AGEYLAGRV
DHAM_ECOLI/251-370 LRPVPPVSG----KAFYYQPVLCTVQAKS.--TLTVEEEQDRLRQAIDFTLLDLMTLTAKAEASGLDDIAAIFSGHHTLLDDPELLAAASELLQHEHCTAEYAWQQVLKELSQQYQQL.DDEYLQARY
PT1_LACSK/4-128 LRGIAASDGIATAKAYMLVQPDLSFSKST.ISD--SEKEINRLHKALQDSTSDLETIRKIAAESLGEEEAQVFDAHMMILADPEFTGAIEGKINDDKVNAEQALKEVADLFVATFESMtNNAYMQERA
Q9KJV2_LACCA/5-129 LKGIAASDGIATAKAYLLVQPDLSFQKKT.VDD--PSKEIDRLKQSLDQSNDELKVIRAKAAESLGEEEAQVFDAHMMILADPDFTGQVETKIKDEKVNAEQALKEVSEFFIKTFEGMtDNPYMQERA
Q99Z66_STRPY/5-129 LKGIAASDGVAVAKAYLLVQPDLSFETVT.VAD--TNAEEARLDVALQAAQDELSVIRENAVESLGEEAAAVFDAHLMVLADPEMISQVKETIRAKQTNAETGLKEVTDMFITIFEGMeDNPYMQERA
PT1_LACLC/5-129 LKGIAASSGVAVAKAYLLVQPDLSFETKT.IAD--TANEEARLDAALATSQSELQLIKDKAVTTLGEEAASVFDAHMMVLADPDMTAQIKAVINDKKVNAESALKEVTDMFIGIFEGMtDNAYMQERA
PT1_BACSU/4-127 LKGIGASAGIAIAKAYRLEEPDLTVEKKN.ISD--SEAEVSRFDEAIARSKEELEKIKEHALKELGQDKADIFSAHLLVLSDPELLNPVKEKISTDSVNAEFALKETSSMFVTMFESM.DNEYMKERA
PT1_BACSI/10-133 IHGIAASSGIAIAKAYRLETPDLAAEKRA.VAD--VEAEVARFEAAVAKAKEELEAIKQHALEKLGEDKAAIFAAHLLVLDDPELLNPIKEKIQTERVNAEYSLDETASFFISMFEAM.DNEYMKERA
PT1_BACME/5-128 IQGIAASSGIAIAKAFRLENPELTVEKKS.VTE--VEAEVARLEAALEKSKSELEIIREHARKELGDDKAEIFEAHLLVLSDPELINPIKDKITNENVNAEHALDEVAAMFINMFESM.DNEYMKERA
PT1_LISIN/5-128 LKGIAASDGIAIAKAYLLVEPDLSYEKTE.VTD--VESEVKRFESALEVSRTELSTIREKAAKDLGEDKAQIFDAHLLVLNDPELTGPIEESIKNAKTNAETALQETTDMFIGMFESM.DNEYMRERA
PT1_STAAN/5-129 IKGIAASDGVAIAKAYLLVEPDLTFDKNEkVTD--VEGEVAKFNSAIEASKVELTKIRNNAEVQLGADKAAIFDAHLLVLDDPELIQPIQDKIKNENANAATALTDVTTQFVTIFESM.DNEYMKERA
PT1_BACHD/5-128 ITGIAASSGVAIAKAFIHLEPNVDIEKTS.ITD--VSTEIEKLTAALEKSKEELRAIKDQTEASMGADKAEIFAAHLLVLDDPELVDGIKGKIENEQMNAEYALKEVSDMFVSMFESM.DNEYMKERA
Q93TM5_LACBR/2-126 LKGIAASDGVVCGHVFRYSEPDLSITKRS.ITN--LDHELNRFHQALEAAVSEVEMIKTRATKNLGADSAQVFSAHIAMLQDPEFIKSVEDEIARQRCNAEAALATVVTDYGASLAKLtDNPYMQERI
Q8XHW9_CLOPE/2-125 KKGIAASKGYAIGTVFIQEHEEIIISDAK.VSD--IAAEKEKLSKALAQSKEQLEAIKEKTANEIGEHEAQVFEAHLMLLDDVEFTGQMEMTIENDQLNAMKAVQNVTDTFVMIFDSM.DDPYMRERA
Q97EM3_CLOAB/3-126 KKGISASKGYAIGHVFIKADNEVKIVEKK.ISD--IESEKARLQGAVEKAREQLTKIKEKAEKDLGADKAAVFESHMMFLDDPDFIGSAENIISDEMINAEKALENVMKNYVAIFEGI.EDEYVKERI
Q98PW7_MYCPU/3-123 LKGIGASRGIAIAKVFRILEDEIEIPKNS.LG---VEKETENFKKTCEKILNELKEIEKKLLIS-KPEEAAIFQAHQDIASDPVMQEEIIDLIKNNK-SAMQAVDEVYQRYSELFESM.DDEYMRERA
PT1_MYCCA/5-128 IKGIAASEGISLARALVIKETKLDIQKQL.ISD--VDQEIIKLEQAIEKSIADLKKIQQITLKKLGEEKAAIFDAHQDIANDPAIKEEVVELIKKEKVNAEYALFTVSNNYFEMFSQL.EDPYFKERS
Q8RI43_FUSNN/11-134 IKGIPASPGIAIGKAFLYKENKLEIDEKS.NLSK--EEEIERLVKGREIAKKQLEEIKENTLKKLGKDKADIFEGHITLLEDEELFSEIDSKISQKKCTAEFALNEAIDEYATMLANL.EDTYFKERA
Q9KTD7_VIBCH/2-127 ISGILASPGIAIGKALLLQEDEIVLNTNT.ISDDQVEAEVERFYTARDKSSAQLEVIKQKALETFGEEKEAIFEGHIMLLEDEELEEEILALIKKEKMSADNAIHTVIEEQATALESL.DDEYLKERA
PT1_SALTY/2-127 ISGILASPGIAFGKALLLKEDEIVIDRKK.ISADKVDQEVERFLSGRAKASAQLEAIKTKAGETFGEEKEAIFEGHIMLLEDEELEQEIIALIKDKHMTADAAAHEVIEGQATALEEL.DDEYLKERA
PT1_BUCAP/2-127 ISGILASPGIAFGNVLLLKKEEIVINRQN.ISTENIKTEINKFFNGRKKSVKQLTEIKIATGEKFGKKKEGIFEGHIMLLEDEELEKEIINLITEKKISAAEATKFIIEGQAKALEKI.KDEYLKNRA
PT1_BUCAI/2-127 ISGILASPGIAFGTALLLKEDEIVINRKI.INIKNITKEIERFFEGRRKSIQQLTEIKTKTKEKFGEKKESIFEGHIMLLEDEELEQEVISLIKEKNMSAAAATELIIEGQAKALEKL.KDEYLKNRA
Q9CMD3_PASMU/2-127 ISGIPASPGIVFGKALVLKEEKIVLDMQK.ISESQIDSEIARFYQGRNAAVEQLSAIRDRAAKTLGEEKAAIFEGHLMILEDEELEEEIIDYLRTNKVNAGVAASKIIDQQVTMLSEI.DDEYLRERA
Q8R7R4_THETN/2-127 LKGVAASPGIAIGKAFLYTKEKVTINVEK.IEESKVEEEIAKFRKALEVTQEEIEKIKEKALKEFGKEKAEIFEAHLMLASDPELIEGVENMIKTELVTADNAVNKVIEQNASVMESL.NDEYLKERA
Q9RGC5_MYCHY/9-130 FKGIGASSGIAIAKVFKLVEQKIEISDQK.VED--ISTEIQIFEEGVKKSVSQIEKIKKLATK-LAKDELEILDAHILIATDPVLKEDTINLIKQGY-SAAYSLKETAKNHTNFLLET.GDEYLMARA
PT1_MYCGE/4-128 IIGIGVSDGIAVAKAFIIQTPQFDVKKYT.NVKMTPTQAKKLLSSAFQKAKKDLEEIKTITVKNINQEAGMIFDAHIQILNDPTITEQLEQQLNKNI-HPVIAVDNVFQQTALMFSEM.DDKYFKERA
PT1_MYCPN/4-128 LSGIGVSDGMALAKAFLVKTPEFAVNKYL.KHQLTKAQAKRLLDSAFKKAVKDLEEIKEITVNNINTEAGMIFDAHIQMLNDPTITEQLEQQLAQNV-HPVIAVDTVFSQTATMFSQM.QDKYFQERA
PT1_BORBU/3-129 LSGKRISKGIGIGEVLCIRKNFDKIISREkIDFSQVDSEISKFNKAKSKAIEALRDLERKAMLQFGDDKKGIFEGQVLIVEDDELDELVIELIVKENYSAAYSIYLAFENLVKSVEDY.KDPYLKERA
Q9RNG5_LEGPN/185-310 LTGIGSVPGIGIGTAVVVYPPADIDAVPR.NPVEELEDEINAFYEALETTRDDIRRLSKRMKETVAEEEHALFDVYLRILDRDSLGAEVEHVIREEKISAQAALATVIKKHVQQFESM.GDDYLRERA
Q9X4P3_PSEAE/178-302 FVGVPGAPGVGVGKAVVVLPPADLEVVPD.KQVDDIDAEIALFKQALEGVRADMRALSSKLASQLRKEERALFDVYLMMLDDASIGNEVKRIIRTGQ-WAQGALRQVVMEHVQRFELM.DDAYLRERA
Q8ZHU9_YERPE/171-295 IRALAAAPGVAVAEGWQDISQPSLDLVYE.ASTLDSTLERERLTQALEEAAAEFRRFSKRFAASSQKESAAIFDLYSHLLNDARLKRELFAQIDAGA-VAEWAVKQVVEAFAAQFASL.QDTYMRERA
Q8Z411_SALTI/171-295 IRALPAAPGVAIATGWQDATMPLMEQVYE.ASTLDTSLERERLTGALEEAANEFRRYSKRFAAGAQKETAAIFDLYSHLLSDARLRRELFAEVDKGA-VAEWAVKKIIEKFAEQFAAL.TDNYLKERA
Q9KU52_VIBCH/171-295 ITGVAASSGVAIGEFWWDDTQPDLSEVLP.ASALDPDFEQERIALAVENALADFRRMRKKLDGDINKEALAIFDLFTHLLNDPMLRKDLKAQIQKGD-RADWALRQVVESYSNRFARM.SDVYLRERA
PT1_ALCEU/5-130 LHGIPVSRGVAIGRAHLLAPAALDVSHYL.VDEDQLDAEVERLRAARAAVRAELAALKRDLPRDAPEELGAFLDVHAMILDDEALAREPEALIRGRRYNAEWALTTRLEELMHQFDEI.EDEYLRERK
Q9JWF8_NEIMA/5-130 LHGVAAGKGIAVGCAHLIARGTEEVPQYD.VAEADTDAEAERFDAAVKATRKELEQLRSAIPENAPTELGAFISLHLMLLTDVTLSREPVDILREQKINAEWALKQQSDKLAAQFDNM.DDAYLRERK
Q9PDH7_XYLFA/20-143 LQGHGAARGAALGRAWVRQMNVMEIQDKY.--ITDTNAELHSLYQAMSAARQEIQVLRERMHGTLSHEVGEFLDLHTLLIDDPELLRSPNELILTHNYSAEYALKIQRDRLTTEFEAM.EDHYLKSRM
Q8P705_XANCP/5-130 LRGHAASRGNALGRARVRQSHTLEVAEQR.VPANQVETQLQRLHAAIAAARTEMQQLRDRLHGALAREVGEFLELHALLLDDPELLQGLDDLIRTHRYSADYALRVQRDRLAAVFDGM.EDAYLRSRM
Q8U8B9_AGRT5/183-304 IDGDAYGEGIGLGHVVLHDPRIVVTNLLN.---EDADTEIRRLADAIGSLRLSIDDMLQRRDVPTEGEHREVLETYRMFAHDQGWVRRMEEAIRNGL-TAEAAVEKVQSDTKARMMRL.TDPYLRERM
Q8YJ96_BRUME/183-304 VSGHGFNDGIGLGHVVLHEPRIVVTNLFN.---EDSQAELNRLDEALGSLRISIDDMLSRRDVAVEGEHREVLEAYRMFAHDRGWVRRLEEAVHNGL-TAEAAVEKVQSDTRARMVHL.TDPYMRERL