EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05523 alignment
(8 sequences with 135 aa)


Q93S92_XANCP/176-306 PGVKLYRMPSFADMR-GSLSVGNFDSFLPFNARRYFLVYGVPTQET-RGEHAHKRCHQFLICVSGSVRVLADDGTRR--IDVELNSPNQGIHLPPMIWGTQYKYSKDAVLLVFASEPYDSDEYIRDYADFKSLAN
O31013_VIBAN/1-131 MDIKFIQFQAHGDDR-GSLVSLEDDKNIPFTIKRVYYLYNTKSGVR-RGFHAHKELKQLAVVLKGSCRFLLDDGSEK--IEVLLDNPEQGLFIDSFVWREMFDFSEDCVLLVLADKFYDEADYIRDYDAFLAEIK
Q8PA23_XANCP/1-133 MAIERIQLHTHGDDR-GLLISLEQQRNVPFEIRRVYYIFGTRQGVH-RGQHAHRQLNQLAVALHGSVTLLLDEGQGQGPEEVVLDDPSQGVLLGRMVWRDLHQFSEDCVLMVLADQYYDPGDYILDYDEFLTEAR
Q9AEE5_LEPIN/7-139 KNSGYINLKKIRDDRDGNLIILESLKDIPFEIKRVYYINNLENSVSVRGQHAHKQIEQAIFCVSGSFTLRLDDGKTK--QEILMNKDNVGVLLGKMLWHAMENFSSGCILLVAASDYYREDDYIRNYSDFIRLAG
Q9ALS4_CAMJE/3-133 KNCKILNLRAIRDNR-GSLIALENNKEVPFEIKRVYYIFDTDPNFP-RGAHAHKNLEQVLIMMSGSCDIILNDGKNY--EKICLNRPDIGLYIGKNMWREMKNFSYGAKLLVLASDFYDEKEYIRNYDEFLRNIN
Q9RGJ6_BACFR/5-135 DNIKLIELPKFMDDR-GNLTFIEKGNQVPFDIRRVYMIYDVPGGEI-RGGHAYKKQVELVIALSGSFEVFLSDGFFE--RIYLLNRSYTGILIPAGIWRRLQNFSTNSLALVLASTSYQESDYIRDYKSFLEYRD
Q9RGJ5_BACFR/8-138 FDCSILELPRIKERC-GNITPIHGLIDLPFEIARVFYLYDIPGGED-RGAHAHKECQQFLIAASGSYEVELNDGINK--RTVLLNRPYYGLHIPPGIWAAERGFSSGSICLVLASHIYDELDYIRDYDEYKNYMQ
Q9ALS3_CAMJE/1-131 MNYTILKFKTINSKN-SILNVHQKDVNCPFEIKRIFYIYDFLDDSI-RGDHANLNSEFIFIALNGSCEILIDDGKTK--QKIILNNKTKGLYIDKMIWKQMYNFSKDCILLVLTNTYYDEKEYIYDYKYFCELKN