EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05480 alignment
(8 sequences with 43 aa)


Q8NX39_STAAW/1-43 MTGLAEAIANTVQAAQQHDSVKLGTSIVDIVANGVGLLGKLFG
Q8NX40_STAAW/1-43 MEGLFNAIKDTVTAAINNDGAKLGTSIVSIVENGVGLLGKLFG
GGI3_STAHA/1-43 MSKLVQAISDAVQAQQNQDWAKLGTSIVGIVENGVGILGKLFG
O88157_STAEP/1-43 MSKLAEAIANTVKAAQDQDWTKLGTSIVDIVESGVSVLGKIFG
GGI1_STAHA/1-43 MQKLAEAIAAAVSAGQDKDWGKMGTSIVGIVENGITVLGKIFG
GGI2_STAHA/1-43 MEKIANAVKSAIEAGQNQDWTKLGTSILDIVSNGVTELSKIFG
P95770_STALU/1-43 MSGIIEAITKAVQAGLDKDWATMGTSIAEALAKGIDAISGLFG
P95769_STALU/1-43 MSGIVDAITKAVQAGLDKDWATMATSIADAIAKGVDFIAGFFN