EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05472 alignment
(6 sequences with 312 aa)


TUS_SALTI/8-309 ERLNGTFRQIEQHLAALSDNLQQHSLLIASVFSLPQVTKEAEHAPLDTIEVTQHLGKEAEALALRHYRHLFIQQQSENRSSKAAVRLPGVLCYQVDNAT-QLDLENQVQRINQLKTTFEQMVTVESGLPSAARFEWVHRHLPGLITLNAYRTLTLINNP--ATIRFGWANKHIIKNLSRDEVLSQLKKSL--ASPRSVPPWTREQWQFKLEREYQDIAALPQQAKLKIKRPVKVQPIARIWYKGQ-----QKQVQHACPSPIIALINTDNGAGVPDIGGLENYDADNIQHRFKPQAQPLRLIIPRLHLYVAD
TUS_ECOLI/8-309 DRLNTTFRQMEQELAIFAAHLEQHKLLVARVFSLPEVKKEDEHNPLNRIEVKQHLGNDAQSLALRHFRHLFIQQQSENRSSKAAVRLPGVLCYQVDNLS-QAALVSHIQHINKLKTTFEHIVTVESELPTAARFEWVHRHLPGLITLNAYRTLTVLHDP--ATLRFGWANKHIIKNLHRDEVLAQLEKSL--KSPRSVAPWTREEWQRKLEREYQDIAALPQNAKLKIKRPVKVQPIARVWYKGD-----QKQVQHACPTPLIALINRDNGAGVPDVGELLNYDADNVQHRYKPQAQPLRLIIPRLHLYVAD
TUS_KLEPO/8-309 ERLNNTFRQIELELQALQQALSDCRLLAGRVFELPAIGKDAEHDPLATIPVVQHIGKTALARALRHYSHLFIQQQSENRSSKAAVRLPGAICLQVTAAE-QQDLLARIQHINALKATFEKIVTVDSGLPPTARFEWVHRHLPGLITLSAYRTLTPLVDP--STIRFGWANKHVIKNLTRDQVLMMLEKSL--QAPRAVPPWTREQWQSKLEREYQDIAALPQRARLKIKRPVKVQPIARVWYAGE-----QKQVQYACPSPLIALMSGSRGVSVPDIGELLNYDADNVQYRYKPEAQSLRLLIPRLHLWLAS
TUS_YERPE/8-309 ERMNTRFAELEVTLHQLHQQLDDLPLIAARVFSLPEIEKGTEHQPIEQITVNITEGEHAKKLGLQHFQRLFLHHQGQHVSSKAALRLPGVLCFSVTDKE-LIECQDIIKKTNQLKAELEHIITVESGLPSEQRFEFVHTHLHGLITLNTYRTITPLINP--SSVRFGWANKHIIKNVTREDILLQLEKSL--NAGRAVPPFTREQWRELISLEINDVQRLPEKTRLKIKRPVKVQPIARVWYQEQ-----QKQVQHPCPMPLIAFCQHQLGAELPKLGELTDYDVKHIKHKYKPDAKPLRLLVPRLHLYVEL
Q9FA33_9ZZZZ/1-291 MDLKKTFEQLTDDLLALKMLISGSSPLFSQVSDIPPVLRGDEHLPISYVAPDHLYGHEAIQKAVDIWSDLHIKH---DFSQKSARRASGVLWFPSEDNAFTVELVRLLSQINALKKSIETHIITTYQ-TRSARFEALHNQCAGVLTLHLYRQIRWWKDEHISAVRFSWQEKESLLIPDKAELLVRMSKEGREDGKKEVP----------LALLMKQIVSVPEE-RLRIRRRLKVQPSANISFRSE-QHPTGKLTMVTAPMPFIIIQNER-----PEVKMLKIYDANERISRKRRNDKVHTEILGTFHGESIE
Q8L2D8_PROVU/1-289 MNIAETFHRLEDSLALLKRVLAQKSPLYARVCVIPPVADGDETLPVNRIEPELLYGAQAIEQTQKAFTDLHIKD---GLSQKSTRRTAGVLWYDDETPEFAAEVMALITSINAIKLSIQEHIITGFS-SQNARFSALHNACPGVMTLHLYRQIRAWHKADIQSIRFSWQKKSLLRIPDKAKLLASMQADVIDNSEVTVP----------VGNLAQRIANTPQD-KLRLRRPAKIQPVANIQFRADIEGEPPTLKTVTALMPYIIIQNQR-----LEVKPLQNYSPRDIQ---RSKDRLATEVIGTFHGETIE