EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05405 alignment
(6 sequences with 215 aa)


AT5F1_DROME/33-243 ERRQRPEHPGKVRLGFLPEEWFQFFYNKTGVTGPYTFGVGLITYLCSKEIYVMEHEYYSGLSLGIMAIIAVKKLGPVIAKWADGEIDKIESEWKEGREAELKVLSDAIEAEKKEQWRADGALLLME----AKKENIALQLEAAFRERAMNVYSEVKRRLDYQVECRHVERRLSQKHMVNWITTNVLASISPQQEKETLNKCIADLSALALRVKSA
Q9IAJ7_XENLA/39-249 PVPPLPEKGGKVRFGLIPEELFQFLYPKTGVTGPYMLGTGLLVYLLSKEIYVINHESFAAASIGICIVYGIKKFGPSVAAFADKLNEEKVAKAQAVKDSAIKNLERAIEEEKKEQWRAEGRHHLFD----AKRNNVSVLLEINYRERLLNVFNEVKKRLDYQVALQHLQRRKEQDHMINWVEKNVVQSITPQQQKESIAKCITDLKLLAKTAQAR
Q20053_CAEEL/94-300 PYPSRPMYPPKTRLLMMPDSWFTAFQKVTGTSGPYLFFGGLFAFLVNKELWVFEEQGHMTVGWILFYLLVSRTAGYKIDAGLYKDYQERVGFFKGLIQEDLK---EAVDFRKTSAAQTASFAALKEGMPTSLKDSMQLQLEAAYRKNVQTISNEIKRRIEYLKETEETKARFERDQLLKLINDSVEKQVSQKDFQEKFLQNAIQ-----QLKGIA
Q19126_CAEEL/96-302 PYPARPMYPPKSRLLMMPDSWFTPFQKVTGVSGPYLFFGGLFAFLVNKELWVFEEQGHMTVGWILFYLLVTRTAGYKIDQGLYNGYQERVNFFKGLIQEDLK---EAVEFKKTSAKQTESLNSIKESYPTALKESMALQLEATYRKNVQSVATELKRRIDYLKETEESKARVEREQLLKLINSEVDKEFSDRSFKDKYLQNAIQ-----QLKGLN
ATPF_YEAST/41-244 EKQTDPKAKANSIINAIPGN---NILTKTGVLG---TSAAAVIYAISNELYVINDESILLLTFLGFTGLVAKYLAPAYKDFADARMKKVSDVLNASRNKHVEAVKDRIDSVSQLQNVAETTKVLFD----VSKETVELESERFELKQKVELAHEAKAVLDSWVRYEASLRQLEQRQLAKSVISRVQSELGNPKFQEKVLQQSIS-EIEQLLSKLK
ATPF_KLULA/34-233 PSPQDPKAKASSILDALPGN---TALSKTGILA---TSAAAAVYAISNQLYVLNEETILVATFTGVVLAGIKFLAPAYNEFAENRVKQVSSILNSSRTKHVDAVKERIESVSELKNVSDTTKVLFD----VSKETVKLEAEAFELKQQVDLAAEAKSVLDSWVRYEASVRQLQQQQIADSVVAKVQSELGNPKFQEKVLQQSVA-----DVEKLL