EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05381 alignment
(13 sequences with 114 aa)


O56254_TYMV/777-878 PQPT-LNCLLSAVSDQTKVSEDHLWESLQTILPDSQLRNEEINSLGLSTEHLTALAHLYNFQATVYSDRGPILFGPSDTIKRIDITHTTGPP----SHFSP-------GKRLLG
POLR_TYMVA/777-885 PQPT-LNCLLSAVSDQTKVSEDHLWESLQTILPDSQLRNEEINSLGLSTEHLTALAHLYNFQATIYSDRGPILFGPSDTIKRIDITHTTGPP----SHFSPGKRLLGSQPSAKG
POLR_TYMV/777-885 PQPT-LNCLLSAVSDQTKVSEEHLWESLQTILPDSQLSNEETNTLGLSTEHLTALAHLYNFQATVYSDRGPILFGPSDTIKRIDITHTTGPP----SHFSPGKRLLGSQPSAKG
POLR_TYMVC/777-885 PQPT-LNCLLSAVSDQTKVSEEHLWESLQTILPDSQLSNEETNTLGLSTEHLTALAHLYNFQATVYSDRGPILFGPSDTIKRIDITHTTGPP----SHFSPGKRLLGSQPSAKG
POLR_KYMVJ/804-912 PMPK-NNCLLTAVAPSLHINPHRLWTSLQEVLPDSLLSNSEIDSVGMSTDLLTALSHLFNFQAVVHSERGDILFGLQSAKTVIHIYHTNGPP----AHYSPPPKIIGSNSPPSS
POLR_EPMV/772-877 --PK-LNCLLTCFSELSGHSESDLWLSLQSILPDSQLQNPEVSTLGLSTDILTALCFIYHSSVTLHAPSGVYHYGIASSSTVYVIHYQPGPP----PHFSL-SPRLAASAPRCN
O91260_PHMV/865-972 PIPK-NKCLLTAFSSQTHYSEESIWHTLQTLLPDSLLSNPEISTLGLSTDILTTLCYYYHLQAVVLCPNRELHFGITTSSQTITLSYEPGPP----RHFSS-RPRLLGSAPHSN
Q9QCX3_9VIRU/764-863 --PA-LCCLLEAFSSETKLPVDDLWLTLRSHLPDSLLSNSEISTYGLSTDLLTALCFFYHLRCSLHTNSGVLLFGIQNSEQHICITHTSGPP----AHYSP-------GARLNG
POLR_OYMV/705-810 PFPQ-KHCLLTAVASQLSYTEHQLWEFLCDMLPDSLLTNSEVENFGLSTDHLTCLSYRLHFECIIHTSHSTIPYGIKKASTVIQISYIDGPP----KHFKA---FIKLAAAAPG
Q8UZB6_9VIRU/808-916 PYPA-LDCLLVSCSAASGIPKEDLWATLCHIFPPSDL----VSDLGLSTNHLTALAFTYQWLVTLRSGELVQRHGLLSAPFAFEITHTPPVPPATVGHFALSAPLTPTSACLTG
P89920_9VIRU/733-842 PYPA-MDCLLVATEQATRISREALWDCLTATCPDSFLDPKSIAQHGLSTDHFVILAHRFSLCANFHSAEHVIQLGMADATSIFMINHTAG-SAGLPGHFSL--RLGDQPRALNG
Q91TW9_9VIRU/715-811 PYPTRAACLLVAVSQATGLPTRTLWAALCANLPDSVLDDGSLATLGLTTDHFAVLARIFSLRCRFVSEHGDVELGLHDATSRFTIRHTP-------GHFEL----------VAD
Q9IW08_9VIRU/731-832 PIPVNQSCLLVAISKATSISLEELWKTLAALLPDSLLLPEDITTRGLSTDHFVVLASAHSLKCIFISGALELELGLHNAHHSFTIRHTS--SANQLPHFEL----------VAD